ESTScan Details for Unigene SGN-U311994

Score 
460
Direction 
Forward
Predicted Peptide Sequence 
MSVTLHTNLGDIKCEIFCDEVPKAAENFMALCASGYYDGTIFHRNIKGFMIQGGDPTGTGKGGTSIWGKKFNDEIRESLKHNARGILSMA
NSGANTNGSQFFITYAKQPHLNGLYTIFGKVIHGFEVLDIMEKTPTGPGDRPLAEIRMNRVPYMPTHLLADIILRSSFWWSLTAIGSH
Predicted Coding Sequence 
ATGTCAGTGACGCTTCATACGAATCTCGGGGACATCAAGTGTGAAATCTTCTGTGATGAGGTTCCTAAAGCTGCCGAGAATTTTATGGCG
CTATGCGCTAGTGGCTATTATGATGGAACCATATTTCACAGAAATATAAAGGGGTTCATGATCCAAGGTGGTGATCCAACTGGTACAGGC
AAAGGTGGGACAAGCATTTGGGGTAAAAAGTTCAATGATGAGATAAGAGAGTCTCTCAAGCACAATGCTAGAGGAATACTATCAATGGCT
AACAGTGGGGCTAATACTAATGGAAGCCAATTCTTTATAACTTATGCAAAGCAACCTCATCTCAATGGGCTTTATACTATCTTTGGGAAA
GTGATCCATGGGTTTGAAGTCCTTGATATAATGGAAAAGACACCAACAGGACCAGGAGACCGACCTCTGGCAGAGATTCGGATGAATCGA
GTACCATACATGCCAACCCACTTGCTGGCTGATATTATCTTAAGATCATCATTTTGGTGGAGCTTAACTGCTATCGGGTCTCATTAG
Edits in Original Sequence 
GGCAAACCCCTTTTATTTCCTTTTTGTTAATTTATGAGCAAAGGAGCTTTCTATCCGTCGCATGGTTTTGGATTATTAATAGTTTCATTT
CTAGGATTCGGACAAGCAAGCGAAAGTCACCAACCAATCCAATCGTCTGGTTCTAGTCTTGCTTGATAA
(5')ATGTCAGTGACGCTTCA
TACGAATCTCGGGGACATCAAGTGTGAAATCTTCTGTGATGAGGTTCCTAAAGCTGCCGAGAATTTTATGGCGCTATGCGCTAGTGGCTA
TTATGATGGAACCATATTTCACAGAAATATAAAGGGGTTCATGATCCAAGGTGGTGATCCAACTGGTACAGGCAAAGGTGGGACAAGCAT
TTGGGGTAAAAAGTTCAATGATGAGATAAGAGAGTCTCTCAAGCACAATGCTAGAGGAATACTATCAATGGCTAACAGTGGGGCTAATAC
TAATGGAAGCCAATTCTTTATAACTTATGCAAAGCAACCTCATCTCAATGGGCTTTATACTATCTTTGGGAAAGTGATCCATGGGTTTGA
AGTCCTTGATATAATGGAAAAGACACCAACAGGACCAGGAGACCGACCTCTGGCAGAGATTCGGATGAATCGAGTgACCATACATGCCAA
CCCACTTGCTGGCTGATATTATCTTAAGATCATCATTTTGGTGcGAGCTTAACTGCTATCGGGTCTCATTAG(3')GATTTATGTCTCCA
TAATGGAGTTGAAAACTAATTATTGATGATCAGAGGGAGAGAGAGATCCCTGGTTTGAATTTGTTAATCTGAACTCCGCAGAATCACTTC
TAATGTAAATTTTCTATCTGAAACGAAACTTTGGATCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan