ESTScan Details for Unigene SGN-U312005

Score 
935
Direction 
Forward
Predicted Peptide Sequence 
KPPRPSPRPKNSQITVPNKQRLILSXSSMADSKPVEVCVKAAAGAPDILGDCPFCHRILLTLEVKKVPYKLHLINTDDKPQWFLAVNPEG
KVPVIKFDDKWISDSDVIVGIIAEKYPEPPLSAPPEASSVASKIFPAFVKFLKSKDPNDGTEQALLEELKALDEHLKAHGPYINGEKISA
VDLSLAPKLYHLETTLDHFKGWKIPENLAHLHNYIKLVFSWETFDKTKAAKEHVIAGWKPKVEAEAVLNYDNDKAPLYSGQDML
Predicted Coding Sequence 
XXGAAACCACCACGTCCTTCCCCTCGCCCCAAAAACTCACAAATCACAGTACCAAACAAGCAAAGACTTATTCTCTCCGAXTCATCAATG
GCTGATTCTAAGCCAGTGGAGGTCTGTGTAAAAGCTGCTGCTGGTGCCCCTGATATTCTTGGAGACTGCCCATTTTGCCATAGGATACTT
TTGACCCTGGAGGTAAAGAAAGTACCTTACAAGTTGCACCTAATCAATACTGATGACAAGCCACAATGGTTCTTGGCTGTGAACCCAGAA
GGGAAGGTGCCAGTGATCAAATTTGATGACAAATGGATTTCTGACTCTGATGTGATAGTTGGGATCATTGCAGAGAAATACCCAGAACCC
CCTCTGTCTGCTCCTCCTGAAGCCTCCTCTGTGGCTTCAAAGATATTCCCTGCTTTTGTCAAGTTTCTAAAGAGCAAGGATCCCAATGAT
GGGACAGAGCAAGCTCTACTAGAAGAACTGAAGGCATTAGATGAACACCTCAAAGCTCATGGACCATATATCAATGGCGAAAAGATATCT
GCTGTTGATTTGAGTTTGGCACCTAAACTGTACCATCTTGAAACAACTCTTGACCATTTCAAGGGCTGGAAAATCCCTGAAAACTTGGCT
CATTTACATAACTACATAAAGCTGGTTTTTTCTTGGGAGACTTTTGACAAAACCAAGGCTGCAAAAGAACATGTGATTGCTGGATGGAAG
CCAAAGGTTGAGGCTGAAGCTGTTCTAAATTACGACAACGACAAAGCTCCTCTCTATTCTGGACAAGACATGCTATAA
Edits in Original Sequence 
(5')XXGAAACCACCACGTCCTTCCCCTCGCCCCAAAAACTCACAAATCACAGTACCAAACAAGCAAAGACTTATTCTCTCCGAXTCATC
AATGGCTGATTCTAAGCCAGTGGAGGTCTGTGTAAAAGCTGCTGCTGGTGCCCCTGATATTCTTGGAGACTGCCCATTTTGCCATAGGAT
ACTTTTGACCCTGGAGGTAAAGAAAGTACCTTACAAGTTGCACCTAATCAATACTGATGACAAGCCACAATGGTTCTTGGCTGTGAACCC
AGAAGGGAAGGTGCCAGTGATCAAATTTGATGACAAATGGATTTCTGACTCTGATGTGATAGTTGGGATCATTGCAGAGAAATACCCAGA
ACCCCCTCTGTCTGCTCCTCCTGAAGCCTCCTCTGTGGCTTCAAAGATATTCCCTGCTTTTGTCAAGTTTCTAAAGAGCAAGGATCCCAA
TGATGGGACAGAGCAAGCTCTACTAGAAGAACTGAAGGCATTAGATGAACACCTCAAAGCTCATGGACCATATATCAATGGCGAAAAGAT
ATCTGCTGTTGATTTGAGTTTGGCACCTAAACTGTACCATCTTGAAACAACTCTTGACCATTTCAAGGGCTGGAAAATCCCTGAAAACTT
GGCTCATTTACATAACTACATAAAGCTGGTTTTTTCTTGGGAGACTTTTGACAAAACCAAGGCTGCAAAAGAACATGTGATTGCTGGATG
GAAGCCAAAGGTTGAGGCgTGAAGCTGTTCTAAATTACGACAACGACAAAGCTCCTCTCTATTCTGtGACAAGACATGCTATAA(3')AT
TGTCGGCACTTTTCTTGTTTTTTTTTTTTTTGGAGTGTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan