ESTScan Details for Unigene SGN-U312109

Score 
204
Direction 
Forward
Predicted Peptide Sequence 
RLGADDXPPEYGCQTNAGEEKDSRLHCGHGLGQALYWSLAGAAESERNLGDLGAPEKPMELPSFPLIFGKRVVKGGIIGSIKETQEMMEV
CGKRNIVCDIEVVRTDQINEALERLANNDVKYRFVIDIAGKKAVPLKNSALAAPGCFFFLAAPGR
Predicted Coding Sequence 
CGATTGGGTGCAGATGATXTTCCTCCTGAGTACGGATGCCAAACTAATGCAGGCGAGGAAAAGGACTCTAGACTTCATTGTGGACACGGT
CTCGGCCAAGCACTCTATTGGTCCCTTGCTGGAGCTGCTGAAAGTGAAAGGAACCTTGGTGATTTGGGGGCACCTGAGAAGCCGATGGAA
CTACCCTCTTTTCCACTGATTTTCGGAAAGAGGGTGGTGAAAGGAGGCATAATTGGAAGCATCAAAGAAACACAAGAGATGATGGAGGTT
TGCGGCAAACGTAACATCGTGTGTGACATCGAAGTCGTCCGGACGGACCAGATTAATGAAGCACTGGAGCGCCTAGCCAACAATGATGTC
AAGTACCGATTTGTCATCGATATCGCCGGAAAGAAAGCCGTTCCACTTAAAAATTCAGCCTTAGCTGCACCGGGTTGTTTTTTTTTTTTA
GCTGCACCCGGTCGTTAA
Edits in Original Sequence 
(5')CGATTGGGTGCAGATGATXTTCCTCCTGAGTACGGATGCCAAACTAATGCAGGCGAGGAAAAGGACTCTAGACTTCATTGTGGACA
CGGTCTCGGCCAAGCACTCTATTGGTCCCTTGCTGGAGCTGCTGAAAGTGAAAGGAACCTTGGTGATTgTGGGGGCACCTGAGAAGCCGA
TGGAACTACCCTCTTTTCCACTGATTTTCGGAAAGAGGGTGGTGAAAGGAGGCATAATTGGAAGCATCAAAGAAACACAAGAGATGATGG
AGGTTTGCGGCAAACGTAACATCGTGTGTGACATCGAAGTCGTCCGGACGGACCAGATTAATGAAGCACTGGAGCGCCTAGCCAACAATG
ATGTCAAGTACCGATTTGTCATCGATATCGCCGGAAAGcAAAGCCGTTCCACTTAAAAATTCAGCCTTAGCTGCACCGGGTTGTTTTTTT
TTTTTAGCTGCACCCGGTCGTTAA(3')TAGTCTAGTCTAGGGTCTACTAGATGGCATGGCAATTCGAAGTCTCGTTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan