ESTScan Details for Unigene SGN-U312119

Score 
407
Direction 
Reverse
Predicted Peptide Sequence 
DRFKELKAFDDSKAGVKGLVDAGVKSLPKIFIRPPEELLEELNLGRSQTEFPVIDLSGIQSGHDQRKSVVDTLRRASEEWGFFQVANHGI
PAKLLNGIVHGTCEFHELDAELKDKYYSRDLSRVVRYSSNIDLYQSNVATWRDTLTINLMTTYQVEPDELPEVCR
Predicted Coding Sequence 
XGTGATCGCTTCAAAGAGCTCAAGGCTTTTGATGATTCGAAAGCTGGTGTGAAAGGACTTGTTGATGCAGGGGTCAAAAGTCTACCCAAA
ATCTTCATTCGGCCACCTGAAGAACTCCTGGAGGAGCTAAACCTTGGCCGTTCCCAGACAGAATTTCCAGTGATAGACCTCAGTGGCATA
CAAAGTGGTCATGATCAAAGGAAGAGTGTTGTTGATACACTAAGGCGAGCATCGGAGGAATGGGGGTTTTTCCAAGTGGCAAATCATGGG
ATTCCAGCAAAACTGTTGAATGGAATTGTACATGGCACCTGCGAGTTTCATGAGCTAGATGCTGAACTGAAGGATAAGTACTATTCTCGT
GATCTGTCGAGAGTAGTGAGATATTCTAGCAATATTGATCTGTATCAATCAAATGTTGCTACTTGGAGAGACACTTTGACCATTAATCTG
ATGACTACTTATCAAGTTGAACCGGATGAATTGCCTGAGGTTTGCAGGTAA
Edits in Original Sequence 
(5')XGTGATCGCTTCAAAGAGCTCAAGGCTTTTGATGATTCGAAAGCTGGTGTGAAAGGACTTGTTGATGCAGGGGTCAAAAGTCTACC
CAAAATCTTCATTCGGCCACCTGAAGAACTCCTGGAGGAGCTAAACCTTGGCCGTTCCCAGACAGAATTTCCAGTGATAGACCTCAGTGG
CATACAAAGTGGTCATGATCAAAGGAAGAGTGTTGTTGATACACTAAGGCGAGCATCGGAGGAATGGGGGTTTTTCCAAGTGGCAAATCA
TGGGATTCCAGCAAAACTGTTGAATGGAATTGTACATGGCACCTGCGAGTTTCATGAGCTAGATGCTGAACTGAAGGATAAGTACTATTC
TCGTGATCTGTCGAGAGTAGTGAGATATTCTAGCAATATTGATCTGTATCAATCAAATGTTGCTACTTGGAGAGACACTTTGACCATTAA
TCTGATGACTACTTATCAAGTTGAACCGGATGAATTGCCTGAGGTTTGCAGGTAA(3')GCTTCCCTTCATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan