ESTScan Details for Unigene SGN-U312286

Score 
216
Direction 
Forward
Predicted Peptide Sequence 
SQLLSTIEADRPEAAIIRSVLAXILTISYDDLDLSIIIIVVIIVIPVRSXALAMPRMLPYQELELKRIHIDMYIYALVMYGTCVVKVRGW
ITTPSPSPGALVASSCNLSSVKIKDVAVLGHGNTLRSQVCMYVVIKLIIYEVFFFLGDQWVDVPPMKHSIVVNLGDQLEVITNGGGGGVL
HRVIAQTDGNRMSLASFYNPGNDAVIYPAPALLEKEAEERKEVYPKFVFDDYMKLYAGLKFQAKEPRFELMKNVEANVTMGPIATA
Predicted Coding Sequence 
XXCTCTCAGCTACTGTCGACAATTGAGGCTGATAGGCCAGAGGCTGCCATCATTAGGAGCGTATTAGCTGAXATCTTGACCATCTCCTAC
GATGATCTCGATCTCTCTATAATCATCATCGTCGTCATCATCGTCATTCCAGTACGTAGCXCTGCTCTTGCTATGCCGCGCATGCTTCCT
TATCAAGAGCTAGAGCTGAAAAGAATACATATAGATATGTATATATATGCATTAGTTATGTATGGTACTTGCGTTGTGAAAGTTAGAGGT
TGGATTACGACTCCAAGTCCTAGTCCTGGCGCTCTGGTTGCTAGTTCTTGCAATCTAAGCTCTGTAAAGATAAAAGATGTTGCTGTACTT
GGACATGGCAACACCTTGCGCTCGCAGGTGTGTATGTACGTAGTAATTAAGCTTATTATATATGAAGTTTTTTTTTTTTTGGGAGATCAA
TGGGTTGATGTCCCTCCAATGAAGCACTCTATTGTGGTCAACCTTGGTGACCAACTCGAGGTGATTACCAATGGGGGGGGCGGGGGTGTG
CTCCACAGAGTCATAGCTCAAACAGATGGAAATAGGATGTCACTTGCTTCATTCTACAATCCAGGTAATGATGCAGTTATTTATCCAGCA
CCAGCACTGCTGGAAAAAGAAGCAGAAGAAAGAAAAGAAGTCTACCCAAAATTTGTTTTTGATGACTACATGAAACTCTATGCTGGACTT
AAATTCCAGGCCAAAGAGCCAAGATTTGAACTCATGAAGAACGTGGAAGCCAATGTTACCATGGGTCCAATTGCAACTGCTTAG
Edits in Original Sequence 
(5')XXCTCTCAGCTACTGTCGACAATTGAGGCTGATAGGCCAGAGGCTGCCATCATTAGGAGCGTATTAGCTGAXATCTTGACCATCTC
CTACGATcGATCTCGATCTCTCTATAATCATCATCGTCGTCATCATCGTCATTCCAGTACGTAGCXCTGCTCTTGCTATGCCGCGCATGC
TTCCTTATCAAGAGCTAGAGCTGAAAAGAATACATATAGATATGTATATATATGCATTAGTTATGTATGGTACTTGCGTTGTGAAAGTTA
GAGGTTGGATTACGACTCCAAGTCCTAGTCCTGGCGCTCTGGTTaGCTAGTTCTTGCAATCTAAGCTCTGTAAAGATAAAAGATGTTGCT
GTACTTGGACATGGCAACACCTTGCGCTCGCAGGTGTGTATGTACGTAGTAATTAAGCTaTATTATATATGAAGTTTTTTTTTTTTTaGG
GAGATCAATGGGTTGATGTCCCTCCAATGAAGCACTCTATTGTGGTCAACCTTGGTGACCAACTCGAGGTGATTACCAATGGGGGGGGCG
GGGGTGTGCTCCACAGAGTCATAGCTCAAACAGATGGAAATAGGATGTCACTTGCTTCATTCTACAATCCAGGTAATGATGCAGTTATTT
ATCCAGCACCAGCACTGCTGGAAAAAGAAGCAGAAGAAAGAAAAGAAGTCTACCCAAAATTTGTTTTTGATGACTACATGAAACTCTATG
CTGGACTTAAATTCCAGGCCAAAGAGCCAAGATTTGAACTCATGAAGAACGTGGAAGCCAATGTTACCATGGGTCCAATTGCAACTGCTT
AG(3')GACTCATAGGAATAAAACAGTGCTAGGATGTTTTCTTCTCCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan