ESTScan Details for Unigene SGN-U312391

Score 
2054
Direction 
Forward
Predicted Peptide Sequence 
LSFSLPRGKMTLLSSLPSTTIHFTLFLQNLQSSAKASSMASISAASATAAAAASTKINTSGTVLPSKSSKLILSSSFTPNPSTLFLHSPA
TTAPSSSSSRHRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASLGNSAPKKYDEIDAAPEERARGITINTATVEYETE
NRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGVPNMVVFLNKEDQVDDEELLELVELEVRELLSSYEF
PGDDIPIHCGSALLALEALMANPTIKRGDDQWVDKIYKLMDSVDEYIPIPQRQTELPFLMAIEDVFSITGRGTVATGRVERGTVKTGEIV
DIVGLKDTRNTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGSITPHTKFEALVYVLKKEEGGRHSPFFAGYRPQFYM
RTTDVTGKVTAIMTDKGEESKMVMPGDRVNMVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILNDELAAEHPFSHMVGFFH
Predicted Coding Sequence 
XGGCTCTCTTTCTCCCTACCAAGAGGAAAGATGACTTTATTATCCTCTCTTCCTTCTACCACAATTCATTTCACTCTCTTTCTCCAAAAT
CTTCAATCCTCAGCAAAAGCTTCTTCCATGGCTTCAATTTCAGCAGCTTCTGCAACTGCTGCTGCTGCTGCTTCTACAAAGATTAATACC
AGTGGTACTGTTCTTCCTTCAAAATCCTCTAAGCTTATCCTTTCATCTTCTTTTACACCAAACCCATCAACCCTTTTCCTCCATTCACCC
GCCACTACTGCACCTTCTTCTTCTTCCTCCCGCCACCGCCGGTTTACTGTCCGAGCTGCGCGTGGTAAATTCGAAAGGAAGAAACCCCAT
GTCAATATTGGTACAATTGGCCATGTTGACCATGGGAAAACCACACTTACAGCTGCTTTGACAATGGCGCTTGCTTCTCTGGGTAACTCC
GCCCCGAAGAAGTATGATGAAATTGATGCTGCCCCTGAAGAAAGGGCTCGTGGTATTACGATTAATACTGCCACAGTGGAGTATGAAACT
GAAAATCGGCATTACGCTCATGTGGATTGCCCTGGTCACGCTGATTATGTGAAGAATATGATTACTGGTGCTGCTCAAATGGATGGAGCT
ATACTTGTTGTTTCAGGAGCTGATGGTCCAATGCCGCAGACTAAGGAACATATTTTGCTTGCTAAGCAAGTGGGTGTCCCTAATATGGTT
GTTTTCTTGAACAAAGAGGACCAAGTTGATGATGAAGAGTTGCTTGAGCTTGTTGAGCTGGAGGTAAGAGAGTTATTGTCAAGTTATGAG
TTTCCTGGTGATGATATTCCTATTCATTGTGGGTCTGCCCTTTTGGCTTTAGAGGCTTTAATGGCTAATCCTACTATTAAAAGGGGTGAT
GATCAATGGGTTGATAAGATTTATAAATTGATGGACTCTGTTGATGAATATATTCCTATTCCACAAAGACAAACTGAATTACCTTTCTTG
ATGGCTATTGAAGATGTGTTTTCTATTACTGGTAGAGGTACAGTGGCTACAGGGAGAGTGGAAAGAGGGACTGTTAAGACAGGGGAAATT
GTTGATATAGTTGGATTGAAGGACACTAGGAACACTACAGTAACAGGAGTTGAGATGTTTCAGAAGATATTGGATGAAGCAATGGCAGGA
GATAATGTGGGGTTGTTGTTGAGAGGTATTCAAAAGATCGATATTCAAAGAGGAATGGTGTTGGCAAAACCTGGATCAATTACTCCACAC
ACCAAGTTTGAAGCTTTGGTGTATGTGTTGAAGAAGGAAGAGGGTGGCAGGCATTCCCCTTTCTTTGCTGGTTATAGGCCACAGTTTTAC
ATGAGAACAACTGATGTGACCGGAAAGGTTACTGCTATTATGACTGACAAGGGAGAAGAATCTAAGATGGTCATGCCTGGTGATCGCGTA
AACATGGTGGTCGAGCTCATTATGCCAGTGGCTTGTGAGCAGGGTATGAGGTTCGCTATTAGGGAAGGAGGAAAGACTGTCGGAGCTGGT
GTTATTCAGAAAATCTTGAATGATGAACTTGCAGCTGAGCATCCCTTTTCACATATGGTCGGATTTTTCCATTGA
Edits in Original Sequence 
(5')XGGCTCTCTTTCTCCCTACCAAGAGGAAAGATGACTTTATTATCCTCTCTTCCTTCTACCACAATTCATTTCACTCTCTTTCTCCA
AAATCTTCAATCCTCAGCAAAAGCTTCTTCCATGGCTTCAATTTCAGCAGCTTCTGCAACTGCTGCTGCTGCTGCTTCTACAAAGATTAA
TACCAGTGGTACTGTTCTTCCTTCAAAATCCTCTAAGCTTATCCTTTCATCTTCTTTTACACCAAACCCATCAACCCTTTTCCTCCATTC
ACCCGCCACTACTGCACCTTCTTCTTCTTCCTCCCGCCACCGCCGGTTTACTGTCCGAGCTGCGCGTGGTAAATTCGAAAGGAAGAAACC
CCATGTCAATATTGGTACAATTGGCCATGTTGACCATGGGAAAACCACACTTACAGCTGCTTTGACAATGGCGCTTGCTTCTCTGGGTAA
CTCCGCCCCGAAGAAGTATGATGAAATTGATGCTGCCCCTGAAGAAAGGGCTCGTGGTATTACGATTAATACTGCCACAGTGGAGTATGA
AACTGAAAATCGGCATTACGCTCATGTGGATTGCCCTGGTCACGCTGATTATGTGAAGAATATGATTACTGGTGCTGCTCAAATGGATGG
AGCTATACTTGTTGTTTCAGGAGCTGATGGTCCAATGCCGCAGACTAAGGAACATATTTTGCTTGCTAAGCAAGTGGGTGTCCCTAATAT
GGTTGTTTTCTTGAACAAAGAGGACCAAGTTGATGATGAAGAGTTGCTTGAGCTTGTTGAGCTGGAGGTAAGAGAGTTATTGTCAAGTTA
TGAGTTTCCTGGTGATGATATTCCTATTCATTGTGGGTCTGCCCTTTTGGCTTTAGAGGCTTTAATGGCTAATCCTACTATTAAAAGGGG
TGATGATCAATGGGTTGATAAGATTTATAAATTGATGGACTCTGTTGATGAATATATTCCTATTCCACAAAGACAAACTGAATTACCTTT
CTTGATGGCTATTGAAGATGTGTTTTCTATTACTGGTAGAGGTACAGTGGCTACAGGGAGAGTGGAAAGAGGGACTGTTAAGACAGGGGA
AATTGTTGATATAGTTGGATTGAAGGACACTAGGAACACTACAGTAACAGGAGTTGAGATGTTTCAGAAGATATTGGATGAAGCAATGGC
AGGAGATAATGTGGGGTTGTTGTTGAGAGGTATTCAAAAGATCGATATTCAAAGAGGAATGGTGTTGGCAAAACCTGGATCAATTACTCC
ACACACCAAGTTTGAAGCTTTGGTGTATGTGTTGAAGAAGGAAGAGGGTGGCAGGCATTCCCCTTTCTTTGCTGGTTATAGGCCACAGTT
TTACATGAGAACAACTGATGTGACCGGAAAGGTTACTGCTATTATGACTGACAAGGGAGAAGAATCTAAGATGGTCATGCCTGGTGATCG
CGTAAACATGGTGGTCGAGCTCATTATGCCAGTGGCTTGTGAGCAGGGTATGAGGTTCGCTATTAGGGAAGGAGGAAAGACTGTCGGAGC
TGGTGTTATTCAGAAAATCTTaGAATGATGAACTTGCAGCTGAGCATCCCTTTTCACATATGGTCGGATTTTTCCATTGA(3')AGTTTA
TTAATCCATTGTCATATATGCGACTTTTTGGTTACTTTTGTTATGTCTTAGAATCTTACTTTAGTTGAAGTATCCTGTTTTATCGCCCAA
TTCTACTGAACTTTTGATAATTTTTCCCGTCTCTTGTTTCACTTATCATTTGCTTGAAAGAAATGATATCATTTGCTCTCATGAAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan