ESTScan Details for Unigene SGN-U312392

Score 
2022
Direction 
Forward
Predicted Peptide Sequence 
EVEMDRKNPFENEYYMRGPIXFAAKDIILLTPPLLTSSPISFKSQSSLLSFSAMASISAAAATATSSPKLLNPSNPLLPSAAKPSKLILS
SSFTPNFSTLLLHSPAATSPTTHHQRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASMGNSAPKKYDEIDAAPEERAR
GITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGVPNMVVFLNKQDQVDDEELLEL
VELEVRELLSSYEFPGDDIPIVSGSALLALEALMANPSIKRGENEWVDKIFTLMDNVDSYIPIPQRQTELPFLMAIEDVFSITGRGTVAT
GRVERGTVRVGETVDIVGLRDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHTKFEALVYVLKKEEGGR
HSPFFSGYRPQFYMRTTDVTGKVTSITTDKGDESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILXVINEQQRISI
QNGPGPCHAIFLIPCHICNVLVTSFLLDHRLLEKSCYKSMLVHLCEFASIFVCLFEKKNILYLVYXLVSIRKNHLLIETQLKHANEXKMH
LIKKKKKPRAEFGTRYIISSTKAKTFTFFSPHFIMSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQT
VSKTGKKTSYWEEPAPASAPELETKPVEEKPVEEKPTETPAEPEPKPTEEKPAETVA
Predicted Coding Sequence 
GAGGTAGAAATGGATAGAAAAAATCCCTTTGAAAATGAGTACTATATGAGAGGCCCTATTXTTTTTGCTGCCAAGGATATAATACTGTTA
ACTCCTCCTCTTCTCACTTCTTCCCCAATTTCTTTCAAATCCCAATCCTCACTCTTATCCTTCTCCGCCATGGCTTCAATTTCAGCAGCG
GCTGCCACCGCCACTTCTTCTCCTAAGCTCCTAAACCCTTCTAATCCCCTTCTTCCTTCCGCTGCTAAACCATCTAAGCTTATCCTATCC
TCTTCATTTACCCCCAACTTTTCTACCCTTCTCCTCCACTCACCCGCCGCTACTTCTCCCACTACCCACCACCAACGCCGCTTCACTGTC
CGTGCTGCCCGTGGCAAATTCGAGAGGAAGAAACCCCATGTCAATATTGGCACTATTGGTCATGTTGACCATGGAAAGACTACCCTTACT
GCTGCTTTAACCATGGCTCTTGCTTCTATGGGTAATTCCGCTCCCAAGAAGTATGATGAAATTGATGCCGCCCCAGAAGAGCGTGCTCGT
GGGATTACTATTAATACGGCTACGGTTGAGTATGAGACTGAGAACCGACACTATGCCCACGTGGACTGCCCCGGTCACGCTGATTATGTC
AAGAACATGATTACTGGTGCTGCCCAGATGGATGGAGCTATTCTTGTTGTTTCCGGTGCTGATGGCCCAATGCCACAGACCAAAGAACAT
ATCTTGCTTGCTAAACAAGTGGGTGTTCCTAATATGGTGGTGTTTTTGAACAAACAAGATCAGGTTGATGATGAAGAGCTTCTTGAGCTT
GTTGAGTTGGAGGTAAGAGAGCTTTTGTCTAGTTATGAGTTCCCTGGTGATGATATTCCTATTGTTTCTGGCTCTGCTCTTTTGGCTTTA
GAGGCTTTAATGGCAAATCCTAGTATTAAGAGAGGTGAAAATGAATGGGTTGATAAGATTTTTACATTAATGGACAATGTTGATAGTTAT
ATTCCTATTCCGCAAAGACAAACTGAGTTGCCTTTTTTGATGGCTATTGAAGATGTGTTTTCAATCACTGGTAGAGGTACAGTGGCAACA
GGGAGAGTAGAGAGAGGGACTGTTAGGGTTGGAGAGACCGTTGATATTGTAGGATTAAGAGACACCAGGTCTACTACCGTGACCGGGGTT
GAAATGTTTCAGAAGATTTTGGATGAAGCAATGGCTGGTGATAATGTGGGATTGTTGTTGAGAGGTATTCAGAAGATTGATATTCAAAGA
GGAATGGTGTTGGCGAAACCGGGAACAATCACTCCTCACACCAAGTTTGAAGCTCTTGTGTATGTTCTGAAAAAGGAGGAGGGTGGCAGG
CATTCCCCATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATTACCACTGACAAA
GGGGATGAATCTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTTGTGAACAAGGGATGAGA
TTTGCCATCAGGGAAGGAGGAAAGACTGTTGGAGCTGGTGTCATTCAGAAAATTCTTGAXGTGATCAACGAGCAGCAGCGCATTTCCATT
CAAAATGGTCCXGGTCCTTGTCATGCAATATTTTTAATCCCTTGTCATATATGCAACGTTTTGGTTACTTCTTTTCTTTTAGATCATAGG
TTGTTGGAGAAATCTTGTTATAAGTCAATGCTAGTGCACCTTTGCGAGTTTGCTTCAATTTTTGTTTGTTTGTTTGAAAAGAAGAACATT
TTGTATCTTGTGTATGXTTTAGTTTCCATCAGGAAAAATCATCTTTTGATTGAAACTCAACTTAAACATGCCAATGAAAAXAAAATGCAT
TTGATAAAAAAAAAAAAAAAACCTCGTGCCGAATTCGGCACGAGGTACATAATTTCTTCCACCAAAGCAAAAACTTTCACATTTTTTTCT
CCACATTTCATCATGTCTCAGACAGTTGTTCTCAAGGTTGGCATGTCATGCCAAGGTTGTGTTGGAGCTGTCAACAGAGTTTTGGGTAAA
ATGGAAGGTGTTGAATCATTTGACATCGATATAAAGGAGCAAAAAGTGACGGTAAAAGGAAATGTGGAACCGGAAGCTGTTTTCCAAACG
GTTTCAAAGACCGGAAAGAAGACATCGTATTGGGAAGAACCAGCACCAGCATCAGCACCAGAACTCGAAACAAAGCCCGTGGAAGAAAAG
CCCGTAGAAGAAAAGCCCACAGAAACACCAGCTGAGCCCGAACCAAAGCCCACAGAAGAAAAGCCTGCAGAAACTGTTGCTTAA
Edits in Original Sequence 
(5')GAGGTAGAAATGGATAGAAAAAATCCCTTTGAAAATGAGTACTATATGAGAGGCCCTATTXTTTTTGCTGCCAAGGATATAATACT
GTTAACTCCTCCTCTTCTCACTTCTTCCCCAATTTCTTTCAAATCCCAATCCTCACTCTTATCCTTCTCCGCCATGGCTTCAATTTCAGC
AGCGGCTGCCACCGCCACTTCTTCTCCTAAGCTCCTAAACCCTTCTAATCCCCTTCTTCCTTCCGCTGCTAAACCATCTAAGCTTATCCT
ATCCTCTTCATTTACCCCCAACTTTTCTACCCTTCTCCTCCACTCACCCGCCGCTACTTCTCCCACTACCCACCACCAACGCCGCTTCAC
TGTCCGTGCTGCCCGTGGCAAATTCGAGAGGAAGAAACCCCATGTCAATATTGGCACTATTGGTCATGTTGACCATGGAAAGACTACCCT
TACTGCTGCTTTAACCATGGCTCTTGCTTCTATGGGTAATTCCGCTCCCAAGAAGTATGATGAAATTGATGCCGCCCCAGAAGAGCGTGC
TCGTGGGATTACTATTAATACGGCTACGGTTGAGTATGAGACTGAGAACCGACACTATGCCCACGTGGACTGCCCCGGTCACGCTGATTA
TGTCAAGAACATGATTACTGGTGCTGCCCAGATGGATGGAGCTATTCTTGTTGTTTCCGGTGCTGATGGCCCAATGCCACAGACCAAAGA
ACATATCTTGCTTGCTAAACAAGTGGGTGTTCCTAATATGGTGGTGTTTTTGAACAAACAAGATCAGGTTGATGATGAAGAGCTTCTTGA
GCTTGTTGAGTTGGAGGTAAGAGAGCTTTTGTCTAGTTATGAGTTCCCTGGTGATGATATTCCTATTGTTTCTGGCTCTGCTCTTTTGGC
TTTAGAGGCTTTAATGGCAAATCCTAGTATTAAGAGAGGTGAAAATGAATGGGTTGATAAGATTTTTACATTAATGGACAATGTTGATAG
TTATATTCCTATTCCGCAAAGACAAACTGAGTTGCCTTTTTTGATGGCTATTGAAGATGTGTTTTCAATCACTGGTAGAGGTACAGTGGC
AACAGGGAGAGTAGAGAGAGGGACTGTTAGGGTTGGAGAGACCGTTGATATTGTAGGATTAAGAGACACCAGGTCTACTACCGTGACCGG
GGTTGAAATGTTTCAGAAGATTTTGGATGAAGCAATGGCTGGTGATAATGTGGGATTGTTGTTGAGAGGTATTCAGAAGATTGATATTCA
AAGAGGAATGGTGTTGGCGAAACCGGGAACAATCACTCCTCACACCAAGTTTGAAGCTCTTGTGTATGTTCTGAAAAAGGAGGAGGGTGG
CAGGCATTCCCCATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATTACCACTGA
CAAAGGGGATGAATCTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTTGTGAACAAGGGAT
GAGATTTGCCATCAGGGAAGGAGGAAAGACTGTTGGAGCTGGTGTCATTCAGAAAATTCTTGAXGTGATCAACGAGCAGCAGCGCATTTC
CATTCAAAATGGTCCXGGTCCTTGTCATGCAATATTTTTAATCCCTTGTCATATATGCAACGTTTTGGTTACTTCTTTTCTTTTAGATCA
TAGGTTaGTTGGAGAAATCTTGTTATAAGTCAATGCTAGTGCACCTTTGCGAGTTTGCTTCAATTTTTGTTTGTTTGTTTGAAAAGAAGA
ACATTTTGTATCTTGTGTATGXTTTAGTTTCCATCAGGAAAAATCATaCTTTTGATTGAAACTCAACTTAAACATGCCAATGAAAAXAAA
ATGCATTTGATAAAAAAAAAAAAAAAACCTCGTGCCGAATTCGGCACGAGGTACATAATTTCTTCtCACCAAAGCAAAAACTTTCACATT
TTTTTCTCCACATTTCATCATGTCTCAGACAGTTGTTCTCAAGGTTGGCATGTCATGCCAAGGTTGTGTTGGAGCTGTCAACAGAGTTTT
GGGTAAAATGGAAGGTGTTGAATCATTTGACATCGATATAAAGGAGCAAAAAGTGACGGTAAAAGGAAATGTGGAACCGGAAGCTGTTTT
CCAAACGGTTTCAAAGACCGGAAAGAAGACATCGTATTGGGAAGAACCAGCACCAGCATCAGCACCAGAACTCGAAACAAAGCCCGTGGA
AGAAAAGCCCGTAGAAGAAAAGCCCACAGAAACACCAGCTGAGCCCGAACCAAAGCCCACAGAAGAAAAGCCTGCAGAAACTGTTGCTTA
A(3')TTAATGGGCTGAAATTTATAGCATATGATTGTGGTTTATCATTCAAGTTTTCTTGTACAACTAAAGCCAAAATGTGATCTTAGCT
GAAATAATTGTCTTGTTTGGTTTTCTTATAATGTTTGATGTCAAATCATGTATCTTGTATTAATATATTTGTGGATGTTTGGATCAAAAA
AAAAAAAACAATTCGAAAATAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan