ESTScan Details for Unigene SGN-U312421

Score 
899
Direction 
Forward
Predicted Peptide Sequence 
MAATAHNNLNAKLVLLGDMGAGKSSLVIRFVKGQFLEFQESTIGAAFFSSTVSVNNSTVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVY
DITSTDSFARAKKWVQELQKQGNPIMVMALAGNKADLEDKRKVTAEEAHLYAEENGLFFMETSAKTAVNVNDIFYEIAKRLPRAQPAQNQ
AGMVLVEEEQKDRELHHAAVKYYHLDRSIDFVNWKHFFALHVVLLREMWSMFIGRYTVEYDVNFEFKSAISEMILLCSFNLYKFEFTPKP
IYLDNWTLLLPKNNGLGXIRFAQFSCWSIRISVQEETGVKQFSLKRIRLPKLATYNEPMLSNNVYFFSHYFFQIDTEFVEVMAFRHVHDX
GLSKVGFVLHLPVKAPVKTDMVDNLEIQDAKWMPLVEFVEQPLIQEDDMFKKIIDIFIARLGKRYCGLSVHQLVSKFDDKLSTLYFNTVD
DPNLNCQAS
Predicted Coding Sequence 
ATGGCGGCAACTGCTCACAATAATCTCAATGCAAAACTCGTGTTGTTGGGGGACATGGGAGCTGGTAAATCAAGCTTGGTTATACGATTC
GTCAAGGGACAATTCCTTGAATTCCAAGAATCGACGATCGGAGCGGCTTTCTTTTCCTCTACTGTTTCGGTTAACAATTCTACGGTGAAG
TTTGAGATCTGGGATACTGCTGGTCAGGAGAGGTACCATAGCTTAGCGCCTATGTATTACAGGGGTGCTGCAGCAGCTATTATCGTCTAT
GACATCACCAGCACTGATTCATTTGCACGGGCAAAGAAATGGGTGCAAGAATTGCAGAAGCAAGGTAATCCGATTATGGTAATGGCTCTT
GCTGGCAATAAGGCTGATCTAGAAGATAAGAGGAAGGTGACTGCAGAAGAAGCACACTTGTACGCTGAGGAAAATGGCCTATTTTTCATG
GAAACCTCTGCCAAAACTGCTGTTAATGTCAACGATATATTTTACGAAATCGCTAAACGATTGCCTAGAGCTCAGCCTGCTCAAAATCAG
GCAGGAATGGTACTTGTTGAAGAAGAGCAGAAGGATCGCGAACTTCATCATGCTGCAGTTAAGTATTATCATCTCGATCGCTCCATTGAT
TTCGTGAACTGGAAACATTTCTTTGCTCTTCATGTTGTGCTGTTACGGGAAATGTGGAGCATGTTTATTGGGAGATATACAGTAGAATAT
GATGTAAACTTTGAATTTAAAAGCGCCATATCTGAGATGATTCTCCTTTGTTCATTTAATCTGTATAAGTTTGAATTTACACCCAAACCA
ATTTATCTTGATAACTGGACGCTGTTACTCCCCAAAAATAATGGTTTAGGTGAXATAAGATTTGCCCAATTTAGTTGTTGGAGCATAAGA
ATTTCAGTGCAGGAGGAAACTGGTGTXAAGCAATTTTCACTTAAACGTATTCGCCTTCCTAAACTAGCAACATATAACGAACCAATGTTA
TCTAACAATGTTTATTTCTTCTCTCATTACTTTTTCCAGATTGATACTGAATTTGTGGAGGTTATGGCTTTCAGGCATGTTCACGATGXT
GGCCTTTCAAAAGTCGGATTTGTTCTTCATCTGCCTGTTAAGGCCCCTGTCAAAACAGACATGGTTGATAATCTAGAAATTCAGGATGCT
AAGTGGATGCCTCTAGTTGAGTTTGTGGAGCAACCTCTAATCCAAGAAGACGACATGTTCAAGAAAATAATCGACATTTTCATCGCTAGA
CTAGGGAAGCGCTACTGCGGATTGTCTGTCCATCAACTGGTTTCCAAATTTGATGACAAACTTTCTACATTGTATTTTAACACTGTTGAT
GATCCAAATTTGAACTGTCAAGCCAGTTAG
Edits in Original Sequence 
GTAAATTGGGATTTCATCATTTTCATCTTCGGCATTTGATC(5')ATGGCGGCAACTGCTCACAATAATCTCAATGCAAAACTCGTGTTG
TTGGGGGACATGGGAGCTGGTAAATCAAGCTTGGTTATACGATTCGTCAAGGGACAATTCCTTGAATTCCAAGAATCGACGATCGGAGCG
GCTTTCTTTTCCTCTACTGTTTCGGTTAACAATTCTACGGTGAAGTTTGAGATCTGGGATACTGCTGGTCAGGAGAGGTACCATAGCTTA
GCGCCTATGTATTACAGGGGTGCTGCAGCAGCTATTATCGTCTATGACATCACCAGCACTGATTCATTTGCACGGGCAAAGAAATGGGTG
CAAGAATTGCAGAAGCAAGGTAATCCGATTATGGTAATGGCTCTTGCTGGCAATAAGGCTGATCTAGAAGATAAGAGGAAGGTGACTGCA
GAAGAAGCACACTTGTACGCTGAGGAAAATGGCCTATTTTTCATGGAAACCTCTGCCAAAACTGCTGTTAATGTCAACGATATATTTTAC
GAAATCGCTAAACGATTGCCTAGAGCTCAGCCTGCTCAAAATCAGGCAGGAATGGTACTTGTTGAcAGAAGAGCAGAAGGATCGCGAACT
TCATCATGCTGCAGTTAAGTATTATCATCTCGATCGCTCCATTGATTTCGTGAACTGGAAACATTTCTTTGCTCTTCATGTTGTGCTGTT
ACGGGAAATGTGGAGCATGTTTATTGGGAGATATACAGTAGAATATGtATGTAAACTTTGAATTTAAAAGCGCCATATCTGAGATGATTC
TCCTTTGTTCATTTAATCTGTATAtAGTTTGAATTTACACCCAAACCAATTTATCTTGATAACTGGACGCTGTTACTCCCCAAAAATAAT
GGTTTAGGTGAXATAAGATTTGCCCAATTTAGTTGTTGGAGCATAAGAATTTCAGTGCAGGAGGAAACTGGTGTXAAGCAATTTTCACTT
AAACGTATTCGCCTTCCTAAACTAGCAACATATAACGAACCAATcGTTATCTAACAATGTTTATTTCTTCTCTCATTACTTTTTCCAGAT
TGATACTGAATTTGTGGAGGTTATGGCTTTCAGGCATGTTCACGATGXTGGCCTTTCAAAAGTCGGATTTGTTCTTCATCTGCCTGTTAA
GGCCCCTGTCAAAACAGAtCATGGTTGATAATCTAGAAATTCAGGATGCTAAGTGGATGCCTCTAGTTGAGTTTGTGGAGCAACCTCTAA
TCCAAGAAGACGACATGTTCAAGAAAATAATCGACATTTTCATCGCTAGACTAGGGAAGCGCTACTGCGGATTGTCTGTCCATCAACTGG
TTTCCAAATTTGATGACAAACTTTCTACATTGTATTTTAACACTGTTGATGATCCAAATTTGAACTGTCAAGCCAGTTAG(3')CATCAC
AAATCAGTATTGTCTTGTGTATATGTGTAATCTATAGGTTATGGATTCTGTAAATATACTTATAAATTATTCAAAAGAACTTGTTATAGA
GAAGGTAACTTTCACATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTCGGGGGGGGGGCCGGGCCCCATTT
CCCCCTTTTGGGGGTTGAAATAAAATTTGGGGGGGCGTTTTTTAAAAAAAGNTGTCGCAACTTAGCATTTTTGTTATCGAGCCTTGTAAA
AATTAGACACACTTATATACTATACAAATTTACCTAGTTCAGTATTATGTTCCTCAGCAGCTAATCACATTATTTCTTTCTTGGATTAAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan