ESTScan Details for Unigene SGN-U312470

Score 
740
Direction 
Forward
Predicted Peptide Sequence 
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIF
VVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK
A
Predicted Coding Sequence 
ATGGGGTTGACATTCACCAAGCTTTTCAGCCGGCTATTTGCCAAGAAGGAAATGCGCATCCTCATGGTTGGACTCGATGCAGCTGGTAAG
ACCACCATATTGTACAAGCTCAAGCTGGGAGAAATCGTCACCACCATTCCAACTATTGGTTTCAATGTGGAAACTGTTGAATACAAGAAC
ATCAGCTTCACCGTTTGGGATGTCGGGGGTCAAGACAAGATCCGTCCATTGTGGAGGCACTATTTCCAGAACACTCAGGGTCTCATTTTT
GTGGTTGATAGCAATGACAGAGACCGTGTAGGGGAGGCAAGAGATGAATTGCACAGGATGTTGAATGAGGATGAGCTTCGGGATGCTGTG
TTGCTTGTTTTTGCTAACAAACAAGATCTTCCTAATGCAATGAATGCTGCTGAAATAACCGACAAGCTTGGACTCCACTCCCTCAGGCAG
CGTCACTGGTACATCCAAAGCACTTGTGCAACTTCTGGAGAGGGACTCTATGAGGGTCTTGATTGGCTTTCTAACAACATCGCCAATAAG
GCCTAA
Edits in Original Sequence 
GTTAATCTCAAGCTCTCTCTCTCTCTCTGAATTCTCGTGCTTTCTCTCACTAGATCCCTCTTTGCCCAAGCTGTTCTTCAGGGATCGTTA
AGAAGAAAGAGAA
(5')ATGGGGTTGACATTCACCAAGCTTTTCAGCCGGCTATTTGCCAAGAAGGAAATGCGCATCCTCATGGTTGGAC
TCGATGCAGCTGGTAAGACCACCATATTGTACAAGCTCAAGCTGGGAGAAATCGTCACCACCATTCCAACTATTGGTTTCAATGTGGAAA
CTGTTGAATACAAGAACATCAGCTTCACCGTTTGGGATGTCGGGGGTCAAGACAAGATCCGTCCATTGTGGAGGCACTATTTCCAGAACA
CTCAGGGTCTCATTTTTGTGGTTGATAGCAATGACAGAGACCGTGTAGGGGAGGCAAGAGATGAATTGCACAGGATGTTGAATGAGGATG
AGCTTCGGGATGCTGTGTTGCTTGTTTTTGCTAACAAACAAGATCTTCCTAATGCAATGAATGCTGCTGAAATAACCGACAAGCTTGGAC
TCCACTCCCTCAGGCAGCGTCACTGGTACATCCAAAGCACTTGTGCAACTTCTGGAGAGGGACTCTATGAGGGTCTTGATTGGCTTTCTA
ACAACATCGCCAATAAGGCCTAA(3')GTCGAAATAGAGTTGTTGCGGATTCATCCTGGATGCAGGCGGGTTTTTATCTAGTTCCATTTA
CTTTTATTTCGTCTTTTTTCTTTCAGACATTCTCTGAATCTGTGTGGTTATGGCATTTGCTTCTTAGGAGGTCACTTTTGAAACGTTTTT
GTAATACAATGGTTGAATGTATGTAATTTGCTGATTAAACTTTAAAAAAAAAAAAAAAAAACTAGCTCTTTTCTGGTTATTTTGCAGTCA
ATTTAAAATGCATATCAAATACCATAATATAAAAACTACTGTGGTATTAAAAATTTAAAAAAAAAAAAAAAAAAAAACTCGAGGGGGGCC
C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan