ESTScan Details for Unigene SGN-U312474

Score 
482
Direction 
Forward
Predicted Peptide Sequence 
LFFRATAEESAVNDSSISRSTYSNLRSPIAVTQRWGCLSPNFLVASXAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV
EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAVLLVFANKQDLPNAMNAAEITDKLGLL
LFDRGTGISRVHVPLLEKGYTRDLIGYRTIFQTRLRASIRFCPXLVARLPISGV
Predicted Coding Sequence 
CTCTTTTTCCGTGCCACAGCAGAGGAAAGCGCGGTGAACGACAGCTCCATTTCGAGATCTACCTATTCGAATCTCCGATCGCCGATCGCC
GTTACACAGAGATGGGGCTGTCTTTCACCAAACTTTTTAGTCGCCTCTXTTGCTAAGAAAGAAATGCGTATTCTTATGGTTGGTCTCGAT
GCTGCTGGTAAAACCACAATTCTCTACAAGCTCAAGTTGGGGGAAATTGTTACTACTATACCTACAATTGGCTTCAACGTGGAAACAGTT
GAATACAAGAACATCAGCTTTACCGTGTGGGATGTTGGGGGTCAGGACAAGATTCGACCTCTATGGAGGCATTATTTCCAGAACACTCAA
GGCCTCATCTTTGTGGTTGACAGCAATGACAGAGACCGTGTTGTTGAGGCAAGGGACGAGCTTCATAGGATGTTGAATGAGGATGAACTA
AGAGAGGCTGTGCTGCTTGTTTTTGCAAACAAACAAGATCTTCCAAACGCAATGAATGCAGCTGAAATCACCGACAAACTTGGACTTCTT
CTCTTCGACAGAGGCACTGGTATATCCAGAGTACATGTGCCACTTCTGGAGAAGGGTTATACGAGGGACTTGATTGGCTATCGAACAATA
TTTCAAACAAGGCTTAGAGCATCAATTAGATTCTGCCCTCXGCTTGTCGCTCGCTTACCTATATCTGGAGTATAG
Edits in Original Sequence 
(5')CTCTTTTTCCGTGCCACAGCAGAGGAAAGCGCGGTGAACGACAGCTCCATTTCGAGATCTACCTATTCGAATCTCCGATCGCCGAT
CGCCGTTACACAGAGATGGGGCTGTCTTTCACCAAACTTTTTAGTCGCCTCTXTTGCTAAGAAAGAAATGCGTATTCTTATGGTTGGTCT
CGATGCTGCTGGTAAAACCACAATTCTCTACAAGCTCAAGTTGGGGGAAATTGTTACTACTATACCTACAATTGGCTTCAACGTGGAAAC
AGTTGAATACAAGAACATCAGCTTTACCGTGTGGGATGTTGGGGGTCAGGACAAGATTCGACCTCTATGGAGGCATTATTTCCAGAACAC
TCAAGGCCTCATCTTTGTGGTTGACAGCAATGACAGAGACCGTGTTGTTGAGGCAAGGGACGAGCTTCATAGGATGTTGAATGAGGATGA
ACTAAGAGAGGCTGTGCTGCTTGTTTTTGCAAACAAACAAGATCTTCCAAACGCAATGAATGCAGCTGAAATCACCGACAAACTTGGACT
TCaTTCTCTTCGACAGAGGCACTGGTATATCCAGAGTACATGTGCCACTTCTGGAGAAGGGTTATACGAGGGACTTGATTGGCTATCGAA
CAATATTTCAAACAAGGCTTAGAGCATCAATTAGATTCTGCCCTCXGCTTGTCGCTCGCTTACCTATATCTGGAGTATAG(3')ATGTTA
AACACCGTTTGGTTATTTTGGATAGAAAGAAGATCAATTTCTGAAAAATATCCTGCATTTCTTTCCCTTTTCATGCTTTGGTTAGTTGCT
ACTTTGCTTGCAATGTAAAACATTAATATTGTTTTTTCGTATCGTAGCCGGAGCTACTTTAACCCTTTTAATTGTGTCTTCCCCGTCTCC
AACACACTTCATCTTCACCCTAGCTTCCGACCCTTGTAATTTTGTATATATATCCATGAATAAATTGATGATATAAAGAAGCATTGATGA
TATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan