ESTScan Details for Unigene SGN-U312707

Score 
711
Direction 
Forward
Predicted Peptide Sequence 
TSLPPLRRSLNLQRRFFPFYFXAMSKLQSDALREAITVIKNDSSEKKRKFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICML
GDAQHVGEAEKIGLEYMDVEGLKKLNKNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATIKFQ
LKKVLCMGVAVGNXGYGGETNLPERADECQLSRVLAKEELAKCEMLVLEEYHGKDSTHLLRTLYYNLCSFRRFDLYAL
Predicted Coding Sequence 
XXAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCCCATTCTACTTTGXAGCCATGAGTAAGCTTCAGAGT
GATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAAGGAAGTTCACCGAAACCATTGAGCTTCAGATTGGT
TTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGCCACACATTCCTCGCCCCAAGATGAAGATTTGCATG
CTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGGATGTGGAAGGTCTGAAGAAGCTTAATAAAAACAAG
AAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTGTTATCAAGCAGATCCCCCGTCTCTTGGGGCCTGGT
TTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGTCTAAGGTAAACGAGACCAAGGCGACTATCAAATTC
CAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAGGAGAAACAAATCTTCCAGAACGTGCAGATGAGTGT
CAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTACTTGAAGAGTACCATGGGAAAGACTCAACGCATCTT
CTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGTTATAG
Edits in Original Sequence 
(5')XXAACTTCTTTGCCACCACTCCGCCGCTCACTCAATTTGCAGAGACGATTCTTCCCATTCTACTTTGXAGCCATGAGTAAGCTTCA
GAGTGATGCCTTAAGAGAAGCCATCACCGTGATTAAGAATGATTCAAGTGAGAAGAAAAGGAAGTTCACCGAAACCATTGAGCTTCAGAT
TGGTTTGAAAAACTATGATCCTCAAAAGGACAAGCGTTTCAGTGGTTCAGTTAAGTTGCCACACATTCCTCGCCCCAAGATGAAGATTTG
CATGCTTGGAGATGCTCAGCACGTGGGAGAGGCAGAAAAGATTGGTTTGGAGTACATGGATGTGGAAGGTCTGAAGAAGCTTAATAAAAA
CAAGAAGTTGGTTAAGAAGCTCGCAAAGAAGTACCATGCTTTCTTGGCATCAGAAGCTGTTATCAAGCAGATCCCCCGTCTCTTGGGGCC
TGGTTTGAACAAGGCAGGTAAGTTTCCTACCCTTGTTTCCCACCAGGAATCACTCGAGTCTAAGGTAAACGAGACCAAGGCGACTATCAA
ATTCCAGTTGAAGAAGGTTCTTTGCATGGGAGTTGCCGTAGGTAATXATGGATATGGAGGAGAAACAAATCTTCCAGAACGTGCAGATGA
GTGTCAACTTTCTCGTGTCCTTGCTAAAGAAGAATTGGCAAAATGTGAGATGCTTGTACTTGAAGAGTACCATGGGAAAGACTCAACGCA
TCTTCTAAGGACATTGTATTACAATCTTTGCAGTTTCAGGCGTTTTGACTTGTACGCGTTATAG(3')ATACTATTGCATTTTTTGTTTA
GTTGTGCTCCTTGGATACTGAGTTGAAAACTTTATATCAGTTTTGTTATGATTTTACTTTTTCTTTTCTCCTTTCTGTTGATTTTCTTGA
ATATTGTCAACTTTCATATCTAAAGGAAAACTCAAATTTTGTGGTTAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan