ESTScan Details for Unigene SGN-U312722

Score 
1442
Direction 
Forward
Predicted Peptide Sequence 
MATQDVRTLSTKEADIQMMLAAEVHLGTKNCDFQMERYAFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPQDIIVQSARPYGQRAVLK
FAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGVLFXDLS
KDGTPDAGAINQGPKWDVMVDLFFYREPEEAKEQEEEVPAIADYADYSASAALGGDWTSSQIPEAQWTADAAAPAVGGGWAGDGAADGGW
DAAAAPAPVPLPVPDVAPTSGATGWE
Predicted Coding Sequence 
ATGGCGACGCAAGATGTAAGGACTCTTTCGACTAAAGAAGCTGACATTCAGATGATGTTGGCTGCTGAAGTTCACCTCGGTACTAAGAAT
TGTGACTTCCAAATGGAGCGATACGCTTTCAAGCGCCGTAACGATGGTATCTACATCATCAACCTTGGAAAGACATGGGAAAAGCTTCAA
ATGGCTGCCAGGGTGATTGTTGCTATTGAGAATCCTCAGGACATCATTGTTCAATCTGCCAGGCCTTATGGACAGAGAGCTGTCTTGAAA
TTTGCTCAATATACTGGTGCACATGCTATTGCTGGACGTCACACCCCTGGAACTTTTACCAATCAGCTTCAGACCTCATACAGTGAGCCA
CGACTCTTGATTCTGACTGATCCAAGAACTGACCATCAGCCAATCAAGGAAGCTGCACTTGGAAACATCCCAACTATTGCTTTCTGTGAC
ACTGATTCTCCAATGCGTTATGTTGACATTGGTATCCCTGCCAATAACAAAGGAAAGCACAGCATTGGTGTTCTTTTCXTGGATCTTAGC
AAGGATGGTACTCCAGATGCTGGGGCCATTAATCAAGGACCTAAATGGGATGTTATGGTTGATCTCTTCTTTTACAGAGAGCCTGAAGAG
GCAAAGGAGCAAGAAGAGGAAGTGCCAGCAATTGCAGATTATGCAGACTACTCTGCGAGTGCTGCCCTTGGTGGTGACTGGACTAGTAGC
CAAATCCCTGAGGCGCAATGGACTGCAGATGCTGCAGCACCTGCAGTAGGTGGTGGTTGGGCTGGAGATGGAGCAGCTGATGGCGGATGG
GATGCAGCAGCAGCCCCTGCACCAGTTCCTCTACCAGTACCAGATGTTGCCCCTACCTCTGGTGCTACAGGCTGGGAATGA
Edits in Original Sequence 
GAAGAGAGAATCTCGATCTGCCGCAAGCCGAAAAAAACCCTAGCAGCAGAAAGGGAAGAAGCAGAGCACAACC(5')ATGGCGACGCAAG
ATGTAAGGACTCTTTCGACTAAAGAAGCTGACATTCAGATGATGTTGGCTGCTGAAGTTCACCTCGGTACTAAGAATTGTGACTTCCAAA
TGGAGCGATACGCTTTCAAGCGCCGTAACGATGGTATCTACATCATCAACCTTGGAAAGACATGGGAAAAGCTTCAAATGGCTGCCAGGG
TGATTGTTGCTATTGAGAATCCTCAGGACATCATTGTTCAATCTGCCAGGCCTTATGGACAGAGAGCTGTCTTGAAATTTGCTCAATATA
CTGGTGCACATGCTATTGCTGGACGTCACACCCCTGGAACTTTTACCAATCAGCTTCAGACCTCATACAGTGAGCCACGACTCTTGATTC
TGACTGATCCAAGAACTGACCATCAGCCAATCAAGGAAGCTGCACTTGGAAACATCCCAACTATTGCTTTCTGTGACACTGATTCTCCAA
TGCGTTATGTTGACATTGGTATCCCTGCCAATAACAAAGGAAAGCACAGCATTGGTGTTCTTTTCXTGGATCTTAGCAAGGATGGTACTC
CAGATGCgTGGGGCCATTAATCAAGGACCTAAATGGGATGTTATGGTTGATCTCTTCTTTTACAGAGAGCCTGAAGAGGCAAAGGAGCAA
GAAGAGGAAGTGCCAGCAATTGCAGATTATGCAGACTACTCTGCGAGTGCTGCCCTTGGTGGTGACTGGACTAGTAGCCAAATCCCTGAG
GCGCAATGGACTGCAGATGCTGCAGCACCTGCAGTAGGTGGTGGTTGGGCTGGAGATGGAGCAGCTGATGGCGGATGGGATGCAGCAGCA
GCCCCTGCACCAGTTCCTCTACCAGTACCAGATGTTGCCCCTACCTCTGGTGCTACAGGCTGGGAATGA(3')GCCTTTTTCCTTCAAGC
TCTTCATCCTTTTTTGGATAAAGATTAGATATTTCGAGTTCTACAATAGATGGTTTTTTAATGGCACAGTTAAAAAGGATTTTGACTTCG
TGGATGTACTGAATTATTTAATCATTGCTAGTGCAGTGTTTCTTTGGAGAATCTGGAAGTGCTTTTGTTTTGAAAGAGTGGAAAAGCAAA
AAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan