ESTScan Details for Unigene SGN-U312828

Score 
449
Direction 
Forward
Predicted Peptide Sequence 
MESKFAHIIVFFLLATSFESLMARKEIDRPEVTELLKEFESDLMCKGKLRWPELIGVPAQYAKGIIEKENPFITDVQIVLNGSPITLDFR
CFRVRIAVNILDVAVSVPVVG
Predicted Coding Sequence 
ATGGAGTCAAAGTTTGCTCACATTATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAAGTCTCATGGCACGAAAAGAAATTGATAGACCA
GAAGTCACAGAACTTCTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAACTAAGGTGGCCAGAACTTATTGGTGTACCAGCACAA
TATGCTAAGGGAATAATTGAGAAGGAAAATCCATTCATAACTGATGTTCAAATAGTATTGAATGGTTCTCCAATCACATTGGATTTTAGG
TGTTTTCGAGTTCGTATTGCTGTAAACATCTTGGATGTTGCTGTATCAGTGCCTGTGGTTGGTTAA
Edits in Original Sequence 
AGAAA(5')ATGGAGTCAAAGTTTGCTCACATTATTGTTTTCTTTCTTCTTGCAACTTCCTTTGAAAGTCTCATGGCACGAAAAGAAATT
GATAGACCAGAAGTCACAGAACTTCTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAACTAAGGTGGCCAGAACTTATTGGTGTA
CCAGCACAATATGCTAAGGGAATAATTGAGAAGGAAAATCCATTCATAACTGATGTTCAAATAGTATTGAATGGTTCTCCAATCACATTG
GATTTTAGGTGTTTTCGAGTTCGTATTGCTGTAAACATCTTGGATGTTGCTGTATCAGTGCCTGTGGTTGGTTAA(3')TTAATGGACCT
TATTATTGAAGTAATTAAGCAGCTACAACATGTCAAAAAATAATTAGGGTTCATGTTTGTTCATTATAATGTCTCCATGAACTCTTACTA
CATAATGGAATAAATAAGTGTGGCTTAATTATATCCTTTTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan