ESTScan Details for Unigene SGN-U312844

Score 
2005
Direction 
Forward
Predicted Peptide Sequence 
MAASVENRQYTHLEPGLSGVGRTFKPRPDSPVRGCNFPPSSNHELPFQKKQNPPIYLDYSSSEDEDDDDEKNEYVQMIKKGKTELEPSIH
DTRDEGTADNWIERNFSLIRLTGKHPFNSEPPLSRLMHHGFITPVPLHYVRNHGPVPKASWSDWTVEVTGLVKRPMKFTMDQLVNEFPSR
ELPVTLVCAGNRRKEQNMVKQTIGFNWGAAAVSTTVWRGVPLRALLKGAVFRVRKKARLMSVSEGSDVLPGGGGSKYGTSIKKEFAMDPS
RDIIVAYMQNGEMLSPDHGFPVRMIIPGFIGGRMVKWLKRIVVTTQESESYYHYKDNRVLPPHVDAELANAEAWWYKPEYIINELNINSV
ITTPCHEEILPINAWTTQRPYTLRGYAYSGGGKKVTRVEVTLDGGETWSVCTLDHPEKPTKMASTGVGAFGHSEVEVLDLLSAKEIAVRA
TDETLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGIVFEHPTQPGNQSGGWMAKERHLEISAVAPPTLKKSISTPFMNTASKMYS
MSEVRKHNSSDSAWIIVHGHIYDASRFLKDHPGGVDSILINAGTDCTEEFDAIHSDKAKKLLEDFRIGELITTGYTSDSSPNSSVHGSSS
ISSFLAPIKELVQTPTRSVALIPREKIPCKLVDKQSISHDVRKFKFALPSEDQVLGLPVGKHIFLCATVDDKLCMRAYTPTSTVDEVGFF
ELVVKIYFKGVHPKFPNGGQMSQHLDSLPIGAFLDVKGPLGHIEYQGKGNFLVHGKQKFAKKLAMIAGGTGITPVYQVMQSILKDPEDDT
EMYVVYANRTEDDILLKDELDAWAEQVPNRVKVWYVVQESITQGWKYSTGFVTESILREHIPEPSHTTLALACGPPPMIQFAINPNLEKM
GYDIKEELLGSKLDGDDDR
Predicted Coding Sequence 
ATGGCGGCATCTGTGGAAAACAGACAGTATACTCACCTTGAACCGGGTTTATCAGGCGTAGGCCGTACTTTCAAGCCTAGGCCTGATTCC
CCGGTTCGTGGTTGCAACTTCCCTCCTTCATCCAACCATGAACTCCCTTTCCAAAAAAAACAAAATCCCCCAATTTACCTTGATTATTCG
TCTAGTGAAGACGAGGATGACGATGACGAAAAAAATGAATACGTTCAAATGATCAAAAAAGGTAAAACTGAATTAGAACCATCAATTCAT
GATACTAGAGATGAAGGTACCGCTGATAATTGGATCGAACGAAACTTTTCCTTAATACGTCTCACCGGTAAACACCCATTCAACTCCGAA
CCACCTTTATCTCGCCTTATGCATCACGGGTTCATCACTCCCGTACCACTTCATTACGTCCGTAACCACGGCCCAGTCCCCAAAGCATCC
TGGTCTGACTGGACTGTGGAAGTTACAGGGCTGGTAAAACGACCAATGAAATTCACAATGGATCAATTAGTTAACGAATTCCCTTCACGT
GAATTGCCTGTCACACTTGTGTGCGCAGGCAATCGTCGTAAAGAGCAGAATATGGTGAAGCAGACAATTGGTTTCAATTGGGGTGCTGCT
GCCGTTTCAACCACCGTATGGCGCGGAGTACCTCTCCGCGCCCTGTTGAAAGGTGCGGTGTTCAGAGTAAGAAAAAAGGCGCGCTTAATG
TCTGTTTCXGAAGGTTCCGATGTTTTGCCTGGAGGTGGTGGTTCAAAGTACGGAACGAGTATAAAGAAGGAATTCGCCATGGATCCATCT
CGTGATATTATTGTAGCTTACATGCAAAACGGAGAAATGTTGTCACCGGATCATGGTTTTCCGGTAAGGATGATTATCCCCGGATTCATC
GGTGGAAGAATGGTGAAATGGTTAAAGAGGATTGTGGTCACTACACAAGAATCGGAAAGCTATTATCATTACAAGGACAATAGAGTCCTC
CCTCCACACGTTGACGCGGAACTTGCCAACGCGGAAGCTTGGTGGTACAAACCAGAGTACATCATCAATGAGCTCAACATAAACTCTGTC
ATTACAACTCCGTGCCATGAAGAAATTTTGCCCATCAATGCGTGGACTACTCAGAGACCTTACACGTTGAGAGGCTATGCTTATTCTGGT
GGAGGTAAAAAGGTAACTCGAGTGGAAGTGACTTTGGATGGAGGAGAGACATGGAGTGTGTGTACACTTGATCACCCAGAGAAGCCAACA
AAGATGGCAAGTACTGGTGTTGGTGCTTTTGGTCACTCXGAGGTTGAGGTGCTTGACTTGCTTAGTGCTAAAGAAATTGCTGTACGAGCT
ACCGATGAGACCCTCAACACTCAACCCGAGAAGCTTATTTGGAACGTCATGGGAATGATGAACAATTGTTGGTTTCGAGTGAAGATGAAT
GTGTGCAAACCTCACAAGGGAGAGATTGGTATAGTGTTTGAGCATCCGACTCAACCTGGAAATCAATCGGGTGGATGGATGGCAAAGGAG
AGACACTTGGAGATATCAGCAGTGGCTCCTCCAACACTAAAGAAGAGTATATCAACTCCTTTCATGAACACAGCTTCGAAGATGTATTCC
ATGTCCGAGGTGAGGAAACACAACTCTTCAGACTCTGCTTGGATCATAGTCCATGGACATATCTACGATGCCTCACGTTTCTTGAAAGAC
CATCCCGGTGGTGTTGACAGCATTCTGATCAATGCTGGAACTGATTGTACTGAGGAATTTGATGCAATTCATTCTGATAAGGCTAAGAAG
CTATTGGAGGACTTTAGGATTGGTGAACTCATAACTACTGGTTACACGTCTGATTCGTCTCCAAACAGTTCTGTCCATGGATCCTCTTCG
ATCAGTAGCTTCTTAGCACCTATTAAGGAGCTTGTTCAAACACCAACAAGGAGTGTAGCTCTCATCCCAAGGGAAAAAATCCCTTGCAAA
CTCGTCGACAAGCAATCCATCTCCCATGATGTTAGGAAATTCAAATTTGCATTACCCTCTGAGGATCAAGTCTTAGGGTTACCTGTTGGC
AAACACATATTCCTCTGTGCCACAGTTGATGACAAACTCTGTATGCGTGCCTACACGCCTACTAGCACAGTCGATGAAGTAGGGTTCTTC
GAGTTGGTTGTCAAGATCTACTTCAAAGGTGTTCACCCTAAATTCCCTAATGGAGGTCAAATGTCACAACATCTTGATTCTCTCCCAATA
GGTGCATTCCTTGACGTTAAAGGTCCATTAGGTCACATTGAATACCAAGGTAAGGGTAATTTCTTAGTCCATGGTAAACAAAAGTTTGCC
AAGAAGTTAGCTATGATAGCGGGTGGAACAGGTATAACTCCAGTATATCAAGTAATGCAATCAATATTGAAAGATCCTGAAGACGATACA
GAGATGTATGTGGTGTATGCAAACAGAACGGAGGATGATATTTTGCTCAAAGACGAACTTGATGCATGGGCAGAGCAAGTTCCAAATAGG
GTTAAAGTATGGTATGTCGTTCAAGAATCCATTACACAAGGATGGAAGTATAGTACAGGATTCGTTACAGAATCGATTCTTAGAGAACAT
ATACCTGAACCATCTCATACAACATTGGCATTAGCATGTGGACCACCTCCAATGATACAATTTGCTATTAATCCAAACTTGGAGAAAATG
GGATATGACATTAAGGAGGAACTATTGGGTTCTAAATTGGATGGTGATGATGATAGATGA
Edits in Original Sequence 
CCGTTCTCACAATATTCGTTCCAAAACCATACAAAGAACCATCAAAATCTAATTAGAAATCTCTTTTTTCTTCTTCCAAATTCCCTCATT
CATAATTTTATTTTAAAAAAATCA
(5')ATGGCGGCATCTGTGGAAAACAGACAGTATACTCACCTTGAACCGGGTTTATCAGGCGTAGG
CCGTACTTTCAAGCCTAGGCCTGATTCCCCGGTTCGTGGTTGCAACTTCCCTCCTTCATCCAACCATGAACTCCCTTTCCAAAAAAAACA
AAATCCCCCAATTTACCTTGATTATTCGTCTAGTGAAGACGAGGATGACGATGACGAAAAAAATGAATACGTTCAAATGATCAAAAAAGG
TAAAACTGAATTAGAACCATCAATTCATGATACTAGAGATGAAGGTACCGCTGATAATTGGATCGAACGAAACTTTTCCTTAATACGTCT
CACCGGTAAACACCCATTCAACTCCGAACCACCTTTATCTCGCCTTATGCATCACGGGTTCATCACTCCCGTACCACTTCATTACGTCCG
TAACCACGGCCCAGTCCCCAAAGCATCCTGGTCTGACTGGACTGTGGAAGTTACAGGGCTGGTAAAACGACCAATGAAATTCACAATGGA
TCAATTAGTTAACGAATTCCCTTCACGTGAATTGCCTGTCACACTTGTGTGCGCAGGCAATCGTCGTAAAGAGCAGAATATGGTGAAGCA
GACAATTGGTTTCAATTGGGGTGCTGCTGCCGTTTCAACCACCGTATGGCGCGGAGTACCTCTCCGCGCCCTGTTGAAAcGGTGCGGTGT
TCAGAGTAAGAAAAAAGGCGCGCTTAATGTCTGTTTCXGAAGGTTCCGATGTTTTGCCTGGAGGTGGTGGTTCAAAGTACGGAACGAGTA
TAAAGAAGGAATTCGCCATGGATCCATCTCGTGATATTATTGTAGCTTACATGCAAAACGGAGAAATGTTGTCACCGGATCATGGTTTTC
CGGTAAGGATGATTATCCCCGGATTCATCGGTGGAAGAATGGTGAAATGGTTAAAGAGGATTGTGGTCACTACACAAGAATCGGAAAGCT
ATTATCATTACAAGGACAATAGAGTCCTCCCTCCACACGTTGACGCGGAACTTGCCAACGCGGAAGCTTGGTGGTACAAACCAGAGTACA
TCATCAATGAGCTCAACATAAACTCTGTCATTACAACTCCGTGCCATGAAGAAATTTTGCCCATCAATGCGTGGACTACTCAGAGACCTT
ACACGTTGAGAGGCTATGCTTATTCTGGTGGAGGTAAAAAGGTAACTCGAGTGGAAGTGACTTTGGATGGAGGAGAGACATGGAGTGTGT
GTACACTTGATCACCCAGAGAAGCCAACAAAGtATGGCAAGTACTGGTGTTGGTGCTTTTGGTCACTCXGAGGTTGAGGTGCTTGACTTG
CTTAGTGCTAAAGAAATTGCTGTACGAGCTACCGATGAGACCCTCAACACTCAACCCGAGAAGCTTATTTGGAACGTCATGGGAATGATG
AACAATTGTTGGTTTCGAGTGAAGATGAATGTGTGCAAACCTCACAAGGGAGAGATTGGTATAGTGTTTGAGCATCCGACTCAACCTGGA
AATCAATCGGGTGGATGGATGGCAAAGGAGAGACACTTGGAGATATCAGCAGTGGCTCCTCCAACACTAAAGAAGAGTATATCAACTCCT
TTCATGAACACAGCTTCGAAGATGTATTCCATGTCCGAGGTGAGGAAACACAACTCTTCAGACTCTGCTTGGATCATAGTCCATGGACAT
ATCTACGATGCCTCACGTTTCTTGAAAGACCATCCCGGTGGTGTTGACAGCATTCTGATCAATGCTGGAACTGATTGTACTGAGGAATTT
GATGCAATTCATTCTGATAAGGCTAAGAAGCTATTGGAGGACTTTAGGATTGGTGAACTCATAACTACTGGTTACACGTCTGATTCGTCT
CCAAACAGTTCTGTCCATGGATCCTCTTCGATCAGTAGCTTCTTAGCACCTATTAAGGAGCTTGTTCAAACACCAACAAGGAGTGTAGCT
CTCATCCCAAGGGAAAAAATCCCTTGCAAACTCGTCGACAAGCAATCCATCTCCCATGATGTTAGGAAATTCAAATTTGCATTACCCTCT
GAGGATCAAGTCTTAGGGTTACCTGTTGGCAAACACATATTCCTCTGTGCCACAGTTGATGACAAACTCTGTATGCGTGCCTACACGCCT
ACTAGCACAGTCGATGAAGTAGGGTTCTTCGAGTTGGTTGTCAAGATCTACTTCAAAGGTGTTCACCCTAAATTCCCTAATGGAGGTCAA
ATGTCACAACATCTTGATTCTCTCCCAATAGGTGCATTCCTTGACGTTAAAGGTCCATTAGGTCACATTGAATACCAAGGTAAGGGTAAT
TTCTTAGTCCATGGTAAACAAAAGTTTGCCAAGAAGTTAGCTATGATAGCGGGTGGAACAGGTATAACTCCAGTATATCAAGTAATGCAA
TCAATATTGAAAGATCCTGAAGACGATACAGAGATGTATGTGGTGTATGCAAACAGAACGGAGGATGATATTTTGCTCAAAGACGAACTT
GATGCATGGGCAGAGCAAGTTCCAAATAGGGTTAAAGTATGGTATGTCGTTCAAGAATCCATTACACAAGGATGGAAGTATAGTACAGGA
TTCGTTACAGAATCGATTCTTAGAGAACATATACCTGAACCATCTCATACAACATTGGCATTAGCATGTGGACCACCTCCAATGATACAA
TTTGCTATTAATCCAAACTTGGAGAAAATGGGATATGACATTAAGGAGGAACTATTGGtGTTCTAAATTGGATGGTGATGATGATAGATG
A(3')TATATCTCTTTGGAGGAATAAATTCTTTTGTATTTTCAGTTGTACATATTGTGTTTTTGTTTATCATCAAAATGTACTACTTCTT
GTAGTTCTTACATTTTAATTTTCTACTCAACTTTAGGTATAAAATGTTGTACTGTGTACTAGTATGTGTATGTCAAAGTTAAGATTGTAT
TCATCATGGAATTACAGTAACTTTGTTGTCACAAGTCTTGTTGTAGAGATTTTTACCAAATTAATGTGTATATATATATAGTAAATTCCA
AAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan