ESTScan Details for Unigene SGN-U312846

Score 
537
Direction 
Forward
Predicted Peptide Sequence 
MSSGGGSGKGGAGRGKQKASKSVSRSSKAGLQFPVGRIARFLKNGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIVPRH
IQLAVRNDEELSKLLGQVTIANGGVLPNIHQNLLPRKAGSGKGDIGSALKSSRTNELPSFEIDLK
Predicted Coding Sequence 
ATGAGTTCCGGCGGTGGATCAGGCAAGGGCGGCGCCGGTAGAGGGAAGCAAAAGGCATCGAAATCTGTGTCTAGGTCTTCAAAGGCGGGT
CTCCAATTCCCCGTCGGTAGGATCGCTCGTTTCCTGAAGAATGGAAAATATGCTGAACGTGTTGGAGCTGGTGCACCAGTTTATCTGTCT
GCCGTCCTTGAATACCTCGCTGCTGAGGTGTTGGAGTTGGCTGGAAATGCAGCAAGGGATAACAAGAAGAATCGTATAGTGCCGAGGCAC
ATTCAGTTGGCTGTCAGAAATGATGAGGAACTGAGCAAGCTTTTGGGTCAAGTTACAATTGCTAATGGAGGTGTCTTGCCTAACATTCAC
CAGAATCTGTTGCCTAGAAAGGCTGGCTCAGGCAAGGGCGATATTGGTTCTGCTCTCAAGAGTTCTAGAACAAATGAACTCCCTAGTTTT
GAAATCGATCTGAAGTGA
Edits in Original Sequence 
AAAACCGAGAGCTAGAATTAGGGTTTTTCTTTCATCGGGAAAAA(5')ATGAGTTCCGGCGGTGGATCAGGCAAGGGCGGCGCCGGTAGA
GGGAAGCAAAAGGCATCGAAATCTGTGTCTAGGTCTTCAAAGGCGGGTCTCCAATTCCCCGTCGGTAGGATCGCTCGTTTCCTGAAGAAT
GGAAAATATGCTGAACGTGTTGGAGCTGGTGCACCAGTTTATCTGTCTGCCGTCCTTGAATACCTCGCTGCTGAGGTGTTGGAGTTGGCT
GGAAATGCAGCAAGGGATAACAAGAAGAATCGTATAGTGCCGAGGCACATTCAGTTGGCTGTCAGAAATGATGAGGAACTGAGCAAGCTT
TTGGGTCAAGTTACAATTGCTAATGGAGGTGTCTTGCCTAACATTCACCAGAATCTGTTGCCTAGAAAGGCTGGCTCAGGCAAGGGCGAT
ATTGGTTCTGCaTCTCAAGAGTTCTAGAACAAATGAACTCCCTAGTTTTGAAATCGATCTGAAGTGA(3')ACAATTCATAGCTTTGTAA
TATAGAATTGGCTCTTGTTTTGATAGTTTTGAATTCAATGGTGCTGTCGACTTTCTGTTTGATTTACAACTTGGAAAGTTTTTGTGATGC
GAATGGAATTACATCTTTTTGCCTGTCAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan