Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U312881

Score 
1671
Direction 
Forward
Predicted Peptide Sequence 
MPALGCCVESAVSPPLGYSFLSTPEIFSSGVPPSTNAVPLTTHWSPELSSDLYRIDGWGAPYFTVNSSGDISVRPHGTDTLPHQEIDLLK
VVKKASDPINSGGLGLQLPLVVRFPDVLKNRLESLQSAFDYAVQSEGYEAHYQGVYPVKCNQDRFVVEDIVKFGTGFRFGLEAGSKPELL
LAMSSLCKGSSEGLLVCNGFKDAEYISLALVARKLQLNTVIVLEQEEELDLVIDISRKMAVQPVIGLRAKLRTKHSGHFGSTSGEKGKFG
LTTTQILRVVRKLKESGMLDCLQLLHFHIGSQIPSTELLADGVGEAAQVYSELVRLGAGMKFIDIGGGLGIDYDGTKSSDSDVSVGYGLQ
DYASTVVQAVRFVCDRKNVKHPVICSESGRAIVSHHSVLIFEAXVFNYHAFSRAVLYESPLLRGEINDDARGDYRNLSAAAIRGEYDTCM
LYADQLKQRCVDQFKDGNLDIEQLAAVDAVCDFVSKAIGASDPVRTYHVNLSVFTSIPDFWAIDQLFPIVPIHKLDEHPSARGILSDLTC
DSDGKIDKFIGGESSLALHELGSGNSAPYYLGMFLGGAYEEALGGLHNLFGGPSVLRVSQSDSPHSFAVTYAVPGPSCADVLRAMQHEPE
LMFETLKHRAEEFVHKEEEVEVSLANSLNQSFHNMPYLAPHHPAVFLGITIAXDENIVGVGAECAIGEEEFW
Predicted Coding Sequence 
ATGCCTGCTTTAGGTTGTTGTGTAGAATCTGCTGTTTCCCCTCCTCTTGGCTATTCCTTCCTTTCCACGCCGGAGATTTTTTCCTCCGGC
GTACCTCCGTCGACAAACGCTGTCCCTCTTACCACCCATTGGTCACCGGAGCTGTCATCTGATCTGTATCGTATTGATGGTTGGGGTGCT
CCGTATTTCACCGTTAATTCTTCCGGTGATATATCTGTCAGGCCCCATGGTACAGATACCCTTCCTCACCAAGAAATTGATCTCCTGAAG
GTCGTGAAAAAGGCTTCCGACCCGATTAATTCTGGTGGGCTCGGGTTACAGCTTCCACTCGTTGTTCGGTTTCCTGATGTTTTGAAGAAC
CGATTGGAGTCTCTTCAATCGGCTTTTGATTATGCTGTTCAATCTGAAGGATATGAGGCTCATTACCAAGGTGTTTATCCTGTAAAATGC
AATCAGGACAGGTTCGTTGTTGAAGATATTGTCAAATTCGGGACGGGTTTCCGGTTTGGTCTTGAAGCTGGGTCAAAACCTGAGCTCCTC
CTGGCCATGAGCTCTCTATGCAAGGGCAGCTCGGAGGGTCTTCTTGTATGCAACGGATTCAAGGATGCAGAATACATTTCACTTGCTTTG
GTTGCAAGAAAGCTCCAATTGAACACGGTGATTGTGCTCGAACAAGAGGAGGAGCTTGATTTGGTGATTGACATCAGCCGTAAAATGGCG
GTCCAGCCTGTAATTGGGCTCCGGGCTAAGCTTAGGACCAAACATTCCGGTCATTTTGGATCCACTTCTGGAGAGAAAGGCAAGTTTGGG
CTTACAACAACTCAGATCCTTCGTGTGGTGAGGAAACTGAAAGAATCCGGAATGTTAGATTGTCTTCAGCTGCTGCATTTCCACATTGGA
TCTCAGATCCCTTCAACGGAGTTGCTTGCTGATGGTGTTGGTGAGGCTGCTCAGGTTTATTCTGAGTTAGTCCGCCTTGGTGCTGGCATG
AAATTCATTGATATTGGTGGTGGGCTTGGAATTGATTATGATGGTACCAAATCTTCCGATTCTGATGTTTCCGTCGGATATGGCCTTCAG
GATTACGCCTCTACAGTGGTTCAAGCTGTCCGGTTTGTTTGTGACCGGAAGAACGTGAAGCATCCGGTGATCTGTAGCGAAAGTGGCAGA
GCAATTGTATCTCATCACTCTGTTCTGATATTTGAAGCTGXTGTCTTCAACTACCACGCGTTCTCAAGAGCTGTCCTCTATGAGTCTCCA
CTCCTTCGTGGAGAAATCAATGATGACGCTCGTGGCGATTACCGGAATCTATCTGCTGCTGCTATTCGCGGAGAGTACGATACCTGTATG
CTTTATGCCGATCAGTTGAAACAGAGGTGTGTGGATCAGTTCAAAGATGGTAATCTGGACATTGAACAGCTTGCTGCCGTAGATGCCGTC
TGTGACTTTGTGTCAAAAGCTATTGGTGCTTCTGACCCTGTTCGCACCTATCATGTGAATCTGTCCGTTTTCACTTCAATTCCTGATTTC
TGGGCAATCGACCAACTATTCCCGATTGTTCCCATCCACAAGCTAGACGAACATCCTTCAGCTCGGGGAATTCTATCCGACTTGACATGT
GACAGTGATGGAAAGATCGATAAATTCATCGGAGGCGAGTCAAGCTTGGCTCTCCATGAATTGGGAAGTGGAAACAGCGCACCTTATTAT
CTGGGAATGTTTTTAGGCGGGGCATATGAGGAAGCCCTCGGCGGACTCCATAACCTATTTGGCGGACCAAGCGTCCTGCGTGTGTCACAG
AGCGACAGCCCTCACAGCTTCGCTGTAACCTATGCAGTCCCTGGGCCTTCCTGTGCTGACGTCCTCCGAGCAATGCAACACGAGCCTGAA
CTCATGTTCGAGACCCTCAAGCACCGTGCAGAGGAATTCGTGCACAAGGAAGAAGAAGTAGAAGTCTCATTGGCCAATAGCCTAAATCAG
TCGTTCCACAACATGCCATATCTTGCACCACATCATCCTGCTGTTTTTCTGGGTATTACTATTGCAAXTGATGAGAATATTGTTGGTGTT
GGCGCAGAATGTGCAATAGGGGAGGAAGAGTTTTGG
Edits in Original Sequence 
ATCGGCCGAATTGGCTCATTTCGCAGTTGTTTACAGTTTTCCTAAACGGAACTCTACCATCTCTTTTTTCCGGTTACCGTTTAGGTTTCC
GACCAATTTTCTTCTTCTCCGGTGAACTATTCCGGTTAAAAGTTGTATGGTGGGGTGTTTGTTTGAATCTTAGGTTTGTGTTTCTGTTGG
TTTTGAGTTTTAATTCTTTGTTTTGATTTAGAAAATTTTGCTTCTTCTGAAGTCGTTGTGGGGATATTCGGGTCGTGTAAGAGTGTGTTA
GAAGGTGATTATCTTTTGATTAAGTTCTTTTTTTGCTTCTTTTGAGGGGGTAGCCGGGGCTCTGGCCTCGGCGGGTTCTAAAGCCCCCAG
CTATTACAACATTGGTCAACAAATCATTTCTGTATAATTAGTTTTACACATTCTTTGATTCTTTTTTTTTTGTGAAGATTTTACGAG
(5')
ATGCCTGCTTTAGGTTGTTGTGTAGAATCTGCTGTTTCCCCTCCTCTTGGCTATTCCTTCCTTTCCACGCCGGAGATTTTTTCCTCCGG
CGTACCTCCGTCGACAAACGCTGTCCCTCTTACCACCCATTGGTCACCGGAGCTGTCATCTGATCTGTATCGTATTGATGGTTGGGGTGC
TCCGTATTTCACCGTTAATTCTTCCGGTGATATATCTGTCAGGCCCCATGGTACAGATACCCTTCCTCACCAAGAAATTGATCTCCTGAA
GGTCGTGAAAAAGGCTTCCGACCCGATTAATTCTGGTGGGCTCGGGTTACAGCTTCCACTCGTTGTTCGGTTTCCTGATGTTTTGAAGAA
CCGATTGGAGTCTCTTCAATCGGCTTTTGATTATGCTGTTCAATCTGAAGGATATGAGGCTCATTACCAAGGTGTTTATCCTGTAAAATG
CAATCAGGACAGGTTCGTTGTTGAAGATATTGTCAAATTCGGGACGGGTTTCCGGTTTGGTCTTGAAGCTGGGTCAAAACCTGAGCTCCT
CCTGGCCATGAGCTCTCTATGCAAGGGCAGCTCGGAGGGTCTTCTTGTATGCAACGGATTCAAGGATGCAGAATACATTTCACTTGCTTT
GGTTGCAAGAAAGCTCCAATTGAACACGGTGATTGTGCTCGAACAAGAGGAGGAGCTTGATTTGGTGATTGACATCAGCCGTAAAATGGC
GGTCCAGCCTGTAATTGGGCTCCGGGCTAAGCTTAGGACCAAACATTCCGGTCATTTTGGATCCACTTCTGGAGAGAAAGGCAAGTTTGG
GCTTACAACAACTCAGATCCTTCGTGTGGTGAGGAAACTGAAAGAATCCGGAATGTTAGATTGTCTTCAGCTGCTGCATTTCCACATTGG
ATCTCAGATCCCTTCAACGGAGTTGCTTGCTGATGGTGTTGGTGAGGCTGCTCAGGTTTATTCTGAGTTAGTCCGCCTTGGTGCTGGCAT
GAAATTCATTGATATTGGTGGTGGGCTTGGAATTGATTATGATGGTACCAAATCTTCCGATTCTGATGTTTCCGTCGGATATGGCCTTCA
GGATTACGCCTCTACAGTGGTTCAAGCTGTCCGGTTTGTTTGTGACCGGAAGAACGTGAAGCATCCGGTGATCTGTAGCGAAAGTGGCAG
AGCAATTGTATCTCATCACTCTGTTCTGATATTTGAAGCTGXTGTCTTCAACTACCACGCGTTCTCAAGAGCTGTCCTCTATGAGTCTCC
ACTCCTTCGTGGAGAAAcTCAATGATGACGCTCGTGGCGATTACCGGAATCTATCTGCTGCTGCTATTCGCGGAGAGTACGATACCTGTA
TGCTTTATGCCGATCAGTTGAAACAGAGGTGTGTGGATCAGTTCAAAGATGGTAATCTGGACATTGAACAGCTTGCTGCCGTAGATGCCG
TCTGTGACTTTGTGTCAAAAGCTATTGGTGCTTCTGACCCTGTTCGCACCTATCATGTGAATCTGTCCGTTTTCACTTCAATTCCTGATT
TCTGGGCAATCGACCAACTATTCCCGATTGTTCCCATCCACAAGCTAGACGAACATCCTTCAGCTCGGGGAATTCTATCCGACTTGACAT
GTGACAGTGATGGAAAGATCGATAAATTCATCGGAGGCGAGTCAAGCTTGGCTCTCCATGAATTGGGAAGTGGAAACAGCGCACCTTATT
ATCTGGGAATGTTTTTAGGCGGGGCATATGAGGAAGCCCTCGGCGGACTCCATAACCTATTTGGCGGACCAAGCGTCCTGCGTGTGTCAC
AGAGCGACAGCCCTCACAGCTTCGCTGTAACCTATGCAGTCCCTGGGCCTTCCTGTGCTGACGTCCTCCGAGCAATGCAACACGAGCCTG
AACTCATGTTCGAGACCCTCAAGCACCGTGCAGAGGAATTCGTGCACAAGGAAGAAGAAGTAGAAGTCTCATTGGCCAATAGCCTAAATC
AGTCGTTCCACAACATGCCATATCTTGCACCACAtTCATCCTGCTGTTTTTCTGGGTATTACTATTGCAAXTGATGAGAATATTGTTGGT
GTTGGCGCAGAATGTGCAATAGGGGAGGAAGAGTTTTGG(3')CCATACTGCGTTGCTTGAAGACTTTTTGTCTTTTCAGTTTGTTGTTT
TAGTAATAAAGTTTGTCGGATGGTATGTTAAATTAATGTAAATTTTTGGTGTAATTTACTAGTTGTGGAGAAAGTTATGGTTCAATCTTT
GTGTAATTTTCTCCTTATCCTATGTAAACTTTTTCCTTATTAAATGAATTTACCTTAGAAATTAAAAAAAAAAAAAAAAAAATAAAAAAA
TAAAAAAAAGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan