ESTScan Details for Unigene SGN-U313017

Score 
407
Direction 
Forward
Predicted Peptide Sequence 
KKQLKKDTASKLKSLVTEVILFSRLFCNVFSSDYPTRMSMITGIVVPGFKMGNFLPDVICSFGWPLFSYIENRVNHCPTTLNCAYMALDF
LQATRVVLDFSHLSVRKLXVEFLMLSTPKVEIRECLIVVXLSIYEIHVTMKLKISFLXFEMVDFLTNRXKFDQEHEQSEEFQHKLKLKVK
EILTDQEWRRRKMAMRISEEEGRLKKDEEETKELWKRKREHEEQWEGTRENRVSSWRDFMKGGKKVKKGEIRPPKLKTEDPNKSYVQRPV
KRG
Predicted Coding Sequence 
XGGAAGAAGCAGCTTAAGAAAGATACTGCTAGTAAATTGAAATCATTAGTTACTGAGGTAATTCTGTTTAGTAGGCTCTTCTGCAATGTC
TTCTCATCAGATTATCCAACTCGAATGTCTATGATTACTGGAATTGTTGTCCCTGGATTTAAAATGGGGAATTTTCTTCCTGATGTTATC
TGTAGCTTTGGTTGGCCTCTTTTTTCTTACATTGAGAACCGTGTTAATCATTGCCCAACCACCTTGAACTGTGCTTATATGGCACTTGAT
TTTCTCCAAGCAACTAGAGTTGTTTTGGACTTCTCTCACCTATCTGTTAGAAAACTTXTTGTTGAATTCCTCATGTTGTCTACCCCAAAG
GTTGAGATAAGGGAATGTTTGATAGTAGTTAAXTTGAGCATTTATGAAATCCATGTTACCATGAAATTGAAAATTAGTTTTCTTAAXTTT
GAGATGGTTGATTTCTTGACTAATAGGGAXAAGTTCGACCAAGAGCATGAGCAATCAGAAGAATTCCAGCATAAGCTGAAGTTGAAGGTG
AAAGAAATCTTAACGGACCAAGAATGGAGGAGGAGAAAAATGGCAATGAGGATATCGGAAGAGGAAGGTCGCTTGAAGAAAGATGAGGAA
GAAACAAAAGAGTTGTGGAAAAGAAAGCGTGAGCATGAAGAGCAGTGGGAAGGAACTAGAGAAAACAGGGTGTCCAGTTGGAGAGATTTC
ATGAAGGGAGGAAAGAAAGTTAAGAAAGGAGAAATTCGACCTCCAAAGTTGAAAACAGAAGATCCCAATAAATCTTACGTTCAACGACCT
GTGAAACGAGGCTAA
Edits in Original Sequence 
(5')XGGAAGAAGCAGCTTAAGAAAGATACTGCTAGTAAATTGAAATCATTAGTTACTGAGGTAATTCTGTTTAGTAGGCTCTTCTGCAA
TGTCTTCTCATCAGATTATCCAACTCGAATGTCTATGATTaACTGGAATTGTTGTCCCTGGATTTAAAATGGGGAATTTTCTTCCTGATG
TTATCTGTAGCTTTGGTTGGCCTCTTTTTTCTTACATTGAGAACCGTGTTAATCATTGCCCAACCACCTTGAACTGTGCTTATATGGCAc
CTTGATTTTCTCCAAGCAACTAGAGTTGTTTTGGACTgTCTCTCACCTATCTGTTAGAAAACTTXTTGTTGAATTCCTCATGTTGTCTAC
CCCAAAGGTTGAGATAAGGGAATGTTTGATAGTAGTTAAXTTGAGCATTTATGAAATCCATGTTACCATGAAATTGAAAATTAGTTTTCT
TAAXTTTGAGATGGTTGATTTCTTGACTAATAGGGAXAAGTTCGACCAAGAGCATGAGCAATCAGAAGAATTCCAGCATAAGCTGAAGTT
GAAGGTGAAAGAAATCTTAACGGACCAAGAATGGAGGAGGAGAAAAATGGCAATGAGGATATCGGAAGAGGAAGGTCGCTTGAAGAAAGA
TGAGGAAGAAACAAAAGAGTTGTGGAAAAGAAAGCGTGAGCATGAAGAGCAGTGGGAAGGAACTAGAGAAAACAGGGTGTCCAGTTGGAG
AGATTTCATGAAGGGAGGAAAGAAAGTTAAGAAAGGAGAAATTCGACCTCCAAAGTTGAAAACAGAAGATCCCAATAAATCTTACGTTCA
ACGACCTGTGAAACGAGGCTAA(3')AACACATGTACGTCAACTAGTTTTGTTTCAGTGATATTTAAAGCTTGTATCCATAGCTAACTTA
ATTATTCTGCAGCAAAATATATTTAGCACTCTATTTTAGATGTATATTTAGCTAGACAAGTACATTCATATATTTCATTTGACATAGATT
TCTGTTTATGAACTGAATCTTGATAGGATTATTTGTGATATGTTATATGCTAATATGCATATACGACGGGTGAGTATTGTGGAGTTTTAT
ATATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATCCCCCCCCCAAGGGGCCCCTTTGAATTTTTTAAAGGG
CCCCCAAAAAATTGGGGGAAAAAAGGGGAAAAAATTTTTCCCGGGGGAAAATTTTTCCCCAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan