ESTScan Details for Unigene SGN-U313100

Score 
972
Direction 
Forward
Predicted Peptide Sequence 
SYQISYVVGQEGDSDIGLDDIKANASKLSFENSKIRDAYIALQYWKTAMFSDPFNFTANWTGPNVCSYGGVFCAPSLTDDSIRVVAGIDL
NHADIAGSLVAELGLLTDLVLFHLNSNRFCGVVPKTFSHLKLLRELDLSNNRFVGGFPKVVLSLPSLKFLDLRFNDFEGPVPSGLFDKDL
DALFLNDNRFRFGIPENLGNSPVSVLVFANNDLGGCIPASIGKMGKTLNELILMNDNLTGCLPMEIGLLNKLTVFDVSFNKIQGSLPSTV
SKMRSVEELNVAHNKLTGVIPASICQLPRLQNFTYSFNYFTGEAPVCAATRSGDGQENCIVGKKNQRSAKECSSDDAKPYDCRKSKCYSP
FATSPSTKPKPKPKPRGPPPPTWKSSGSHNKRSPXPPKSTPLPSPAPYKKSPTYQHRSPPPPT
Predicted Coding Sequence 
XXGTCTTACCAGATCTCGTATGTGGTAGGACAAGAAGGTGATAGCGATATCGGATTAGATGACATTAAGGCTAATGCTAGTAAGTTGAGT
TTTGAAAACTCAAAGATTCGCGATGCTTATATCGCGTTGCAGTATTGGAAAACAGCAATGTTTTCTGATCCTTTTAACTTCACAGCTAAT
TGGACAGGTCCAAATGTGTGTTCCTATGGTGGAGTGTTTTGTGCTCCTTCGTTAACGGATGATTCGATTAGAGTTGTAGCTGGCATTGAT
CTTAATCATGCTGATATTGCTGGTTCATTAGTTGCAGAACTTGGTCTTCTTACAGATCTGGTTCTTTTCCATCTCAACTCGAATCGTTTT
TGTGGAGTTGTACCAAAAACCTTTAGCCATTTGAAGCTTCTTAGGGAGCTTGATTTGAGTAATAATAGGTTTGTTGGTGGGTTTCCTAAG
GTAGTTCTTTCACTACCTTCTTTGAAGTTTTTGGATCTAAGGTTTAATGACTTTGAAGGACCAGTTCCTTCAGGACTTTTCGATAAAGAT
TTGGATGCGTTGTTTTTGAATGACAATAGATTCCGTTTTGGCATCCCGGAGAACTTGGGTAACTCTCCTGTTTCGGTTCTTGTGTTTGCT
AATAACGATCTTGGAGGGTGTATTCCCGCAAGTATTGGGAAAATGGGGAAAACGTTGAATGAGTTGATATTGATGAATGATAACCTCACT
GGGTGTTTGCCAATGGAGATTGGATTGTTGAACAAGTTAACCGTGTTTGATGTTAGCTTCAACAAGATTCAAGGCTCATTGCCATCAACT
GTGAGCAAAATGAGGAGTGTGGAGGAACTGAATGTGGCTCACAACAAGCTTACTGGGGTTATACCAGCTAGCATTTGCCAACTTCCTAGG
TTGCAAAACTTTACGTATTCCTTCAATTACTTCACCGGGGAAGCTCCAGTTTGTGCTGCGACTAGATCTGGTGACGGCCAGGAGAACTGT
ATCGTTGGAAAGAAGAATCAAAGATCTGCTAAAGAATGCTCTTCGGATGATGCAAAACCGTATGATTGTAGGAAATCCAAGTGTTATAGC
CCTTTTGCTACATCTCCTTCGACAAAGCCAAAACCAAAACCAAAGCCAAGAGGCCCACCACCACCTACTTGGAAGTCTTCGGGTTCGCAT
AACAAGCGATCTCCGNCGCCACCTAAATCAACTCCTCTTCCTTCACCAGCACCTTACAAAAAGTCCCCAACCTATCAACATAGAAGTCCA
CCACCACCTACT
Edits in Original Sequence 
(5')XXGTCTTACCAGATCTCGTATGTGGTAGGACAAGAAGGTGATAGCGATATCGGATTAGATGACATTAAGGCTAATGCTAGTAAGTT
GAGTTTTGAAAACTCAAAGATTCGCGATGCTTATATCGCGTTGCAGTATTGGAAAACAGCAATGTTTTCTGATCCTTTTAACTTCACAGC
TAATTGGACAGGTCCAAATGTGTGTTCCTATGGTGGAGTGTTTTGTGCTCCTTCGTTAACGGATGATTCGATTAGAGTTGTAGCTGGCAT
TGATCTTAATCATGCTGATATTGCTGGTTCATTAGTTGCAGAACTTGGTCTTCTTACAGATCTGGTTCTTTTCCATCTCAACTCGAATCG
TTTTTGTGGAGTTGTACCAAAAACCTTTAGCCATTTGAAGCTTCTTAGGGAGCTTGATTTGAGTAATAATAGGTTTGTTGGTGGGTTTCC
TAAGGTAGTTCTTTCACTACCTTCTTTGAAGTTTTTGGATCTAAGGTTTAATGACTTTGAAGGACCAGTTCCTTCAGGACTTTTCGATAA
AGATTTGGATGCGTTGTTTTTGAATGACAATAGATTCCGTTTTGGCATCCCGGAGAACTTGGGTAACTCTCCTGTTTCGGTTCTTGTGTT
TGCTAATAACGATCTTGGAGGGTGTATTCCCGCAAGTATTGGGAAAATGGGGAAAACGTTGAATGAGTTGATATTGATGAATGATAACCT
CACTGGGTGTTTGCCAATGGAGATTGGATTGTTGAACAAGTTAACCGTGTTTGATGTTAGCTTCAACAAGATTCAAGGCTCATTGCCATC
AACTGTGAGCAAAATGAGGAGTGTGGAGGAACTGAATGTGGCTCACAACAAGCTTACTGGGGTTATACCAGCTAGCATTTGCCAACTTCC
TAGGTTGCAAAACTTTACGTATTCCTTCAATTACTTCACCGGGGAAGCTCCAGTTTGTGCTGCGACTAGATCTGGTGACGGCCAGGAGAA
CTGTATCGTTGGAAAGAAGAATCAAAGATCTGCTAAAGAATGCTCTTCGGATGATGCAAAACCGTATGATTGTAGGAAATCCAAGTGTTA
TAGCCCTTTTGCTACATCTCCTTCGACAAAGCCAAAACCAAAACCAAAGCCAAGAGGCCCACCACCACCTACTTGGAAGTCTTCGGGTTC
GCATAACAAGCGATCTCCGNCGCCACCTAAATCAACTCCTCTTCCTTCACCAGCACCTTACAAAAAGTCCCCAACCTATCAACATAGAAG
TCCACCACCACCTACT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan