ESTScan Details for Unigene SGN-U313206

Score 
1112
Direction 
Forward
Predicted Peptide Sequence 
MAAATMALSSPSFAGQAVKLLPSASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLNGEFPGDYGWDTAGLSADPET
FAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGP
LGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Predicted Coding Sequence 
ATGGCAGCTGCTACAATGGCTCTTTCTTCCCCTTCTTTTGCTGGACAAGCAGTGAAACTCTTACCATCTGCCTCAGAAATCACAGGAAAT
GGAAGGATCACTATGAGAAAGGCTGTCGCAAAGTCAGCCCCATCTAGCAGCCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGTCCA
TTCTCTGGTGAGTCCCCTAGCTACTTGAATGGTGAATTCCCTGGTGACTACGGGTGGGACACCGCTGGACTTTCAGCAGATCCAGAAACC
TTTGCCAAGAACCGTGAACTCGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGCTCTTGGCCCGT
AATGGTGTCAAGTTTGGTGAGGCTGTCTGGTTCAAGGCTGGATCTCAAATCTTCAGTGAGGGTGGACTTGACTACTTGGGCAACCCAAGC
TTGGTCCATGCACAGAGCATCTTGGCCATCTGGGCTTGCCAAGTTGTACTCATGGGAGCCGTTGAAGGTTACCGTATTGCTGGTGGACCT
CTTGGTGAGGTTGTAGACCCACTCTACCCCGGTGGAAGCTTCGACCCATTAGGCCTTGCTGAAGACCCTGAGGCATTTGCTGAGCTCAAG
GTAAAGGAGATTAAGAACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCCATTGTTACTGGAAAGGGACCATTGGAG
AACCTTGCTGATCACCTTGCAGACCCAGTAAACAACAACGCCTGGTCCTACGCCACAAACTTTGTCCCCGGAAAATAA
Edits in Original Sequence 
TCGAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGACATAAAACGAAATTATAAGGTCCTCATTTGGGAACTTAAAACCCCATCAA
TTCATTGCCGCTAACAAAACAGAGTTGTGTAGTAAAAAAGTTAATGAAAATAGAACACTGAAACAAAGCTAAACACAGTGATATATGTCT
GAAAGCAATCCACTATAAATATGCCAACTTCAACAATATCTCATACCATCAAACACTTACATTTCTCTTGATATAAACACC
(5')ATGGC
AGCTGCTACAATGGCTCTTTCTTCCCCTTCTTTTGCTGGACAAGCAGTGAAACTCTTACCATCTGCCTCAGAAATCACAGGAAATGGAAG
GATCACTATGAGAAAGGCTGTCGCAAAGTCAGCCCCATCTAGCAGCCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGTCCATTCTC
TGGTGAGTCCCCTAGCTACTTGAATGGTGAATTCCCTGGTGACTACGGGTGGGACACCGCTGGACTTTCAGCAGATCCAGAAACCTTTGC
CAAGAACCGTGAACTCGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGCTCTTGGCCCGTAATGG
TGTCAAGTTTGGTGAGGCTGTCTGGTTCAAGGCTGGATCTCAAATCTTCAGTGAGGGTGGACTTGACTACTTGGGCAACCCAAGCTTGGT
CCATGCACAGAGCATCTTGGCCATCTGGGCTTGCCAAGTTGTACTCATGGGAGCCGTTGAAGGTTACCGTATTGCTGGTGGACCTCTTGG
TGAGGTTGTAGACCCACTCTACCCCGGTGGAAGCTTCGACCCATTAGGCCTTGCTGAAGACCCTGAGGCATTTGCTGAGCTCAAGGTAAA
GGAGATTAAGAACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCCATTGTTACTGGAAAGGGACCATTGGAGAACCT
TGCTGATCACCTTGCAGACCCAGTAAACAACAACGCCTGGTCCTACGCCACAAACTTTGTCCCCGGAAAATAA(3')AAATCTTAAAACA
TTCTCAAGTTTCTGATCATTTGTTGACCATGTAAAGTTGTAATTTGTGAGTTTACTTGAACAATAGAATTGATTTTTCTTAAAAAAAAAA
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan