ESTScan Details for Unigene SGN-U313210

Score 
1133
Direction 
Forward
Predicted Peptide Sequence 
MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPET
FAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGP
LGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPXKMNLLK
RSQVSGRLMTV
Predicted Coding Sequence 
ATGGCAGCTGCTACAATGGCTCTTTCTTCCCCTTCATTTGCTGGACAGGCAGTCAAACTCTCACCATCTGCCTCAGAAATTTCTGGAAAT
GGAAGGATCACTATGAGAAAGGCTGTTGCCAAGTCCGCCCCATCTAGCAGCCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGCCCA
TTCTCTGGTGAGTCCCCAAGCTACTTGACCGGTGAATTTCCTGGTGATTACGGGTGGGATACCGCTGGACTTTCAGCAGACCCTGAAACT
TTTGCCAAGAACCGTGAACTTGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGCTCTTGGCCCGT
AATGGTGTCAAGTTCGGTGAGGCTGTGTGGTTCAAGGCCGGATCCCAGATCTTCAGTGAAGGTGGACTTGACTACTTGGGCAACCCAAGC
TTGGTCCATGCACAAAGCATCTTGGCCATCTGGGCTTGCCAAGTTGTGTTGATGGGAGCTGTTGAGGGATACCGTATTGCTGGTGGACCT
CTTGGTGAGGTTGTCGACCCACTCTACCCTGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCAGAGGCATTTGCTGAGCTCAAG
GTAAAGGAGATCAAGAACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGTCCATTGGAG
AACCTTGCTGACCACCTTGCAGACCCCGTAAACAACAATGCCTGGGCTTTCGCCACAAACTTTGTCCCCGXGAAAATGAATCTCTTAAAA
CGTTCTCAAGTCTCTGGTCGTTTGATGACAGTGTAA
Edits in Original Sequence 
GGCGATTGGCGGCCAATCGGCCGAATTGATCACCCATCAAACACTTAATTCTTCTCTTAAAATAAACACAA(5')ATGGCAGCTGCTACA
ATGGCTCTTTCTTCCCCTTCATTTGCTGGACAGGCAGTCAAACTCTCACCATCTGCCTCAGAAATTTCTGGAAATGGAAGGATCACTATG
AGAAAGGCTGTTGCCAAGTCCGCCCCATCTAGCAGCCCATGGTATGGCCCTGACCGTGTTAAGTACTTGGGCCCATTCTCTGGTGAGTCC
CCAAGCTACTTGACCGGTGAATTTCCTGGTGATTACGGGTGGGATACCGCTGGACTTTCAGCAGACCCTGAAACTTTTGCCAAGAACCGT
GAACTTGAGGTGATCCACTGCAGATGGGCTATGCTTGGTGCTCTTGGATGTGTCTTCCCTGAGCTCTTGGCCCGTAATGGTGTCAAGTTC
GGTGAGGCTGTGTGGTTCAAGGCCGGATCCCAGATCTTCAGTGAAGGTGGACTTGACTACTTGGGCAACCCAAGCTTGGTCCATGCACAA
AGCATCTTGGCCATCTGGGCTTGCCAAGTTGTGTTGATGGGAGCTGTTGAGGGATACCGTATTGCTGGTGGACCTCTTGGTGAGGTTGTC
GACCCACTCTACCCTGGTGGCAGCTTCGACCCATTAGGCCTTGCTGAAGACCCAGAGGCATTTGCTGAGCTCAAGGTAAAGGAGATCAAG
AACGGTAGACTTGCTATGTTCTCTATGTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGTCCATTGGAGAACCTTGCTGACCAC
CTTGCAGACCCCGTAAACAACAATGCCTGGGCTTTCGCCACAAACTTTGTCCCCGXGAAAATGAATCTCTTAAAACGTTCTCAAGTCTCT
GGTCGTTTGATGACAGTGTAA(3')AGATGTAGTGTGCTACCTGACAATATAATGAAATTTTGTTTGTGTTTGAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan