ESTScan Details for Unigene SGN-U313222

Score 
1195
Direction 
Forward
Predicted Peptide Sequence 
MAASTMALSSSTFAGKTVKLAPSSSEISGNGRITMRKTAAKPKPASXGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL
LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADPLADPVNNNAWAFATNFVPGK
Predicted Coding Sequence 
ATGGCTGCTTCTACAATGGCTCTTTCCTCCTCTACCTTCGCCGGAAAGACGGTGAAACTCGCACCATCTTCTTCTGAAATCAGTGGAAAT
GGGAGAATTACAATGAGGAAGACTGCTGCCAAGCCCAAGCCAGCTTCCXCTGGTGATTACGGATGGGACACTGCTGGGCTTTCAGCTGAC
CCTGAAACATTCGCTAAGAATCGTGAGTTGGAGGTTATTCATTGCAGATGGGCCATGCTTGGTGCTCTTGGATGTGTTTTCCCCGAGCTT
TTGGCACGTAACGGTGTTAAGTTTGGTGAAGCTGTATGGTTCAAAGCTGGATCTCAAATTTTCAGCGAGGGCGGACTTGACTACTTGGGA
AACCCTAGTTTGGTTCATGCACAAAGCATTTTGGCTATTTGGGCTTGCCAAGTTGTGTTGATGGGAGCTGTTGAGGGTTACCGTATTGCT
GGTGGGCCTCTTGGTGAGGTTGTTGACCCACTCTACCCTGGTGGTAGCTTTGACCCATTGGGCCTTGCTGAAGACCCAGAGGCTTTTGCT
GAGCTTAAAGTTAAGGAAATTAAGAATGGTAGACTTGCTATGTTCTCCATGTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGA
CCATTGGAGAACCTTGCTGACCCCCTTGCAGACCCAGTTAACAACAACGCCTGGGCTTTTGCTACAAACTTTGTTCCCGGAAAGTGA
Edits in Original Sequence 
CACAATTCATTTCTTTTTATTTATTAAAATTAAACC(5')ATGGCTGCTTCTACAATGGCTCTTTCCTCCTCTACCTTCGCCGGAAAGAC
GGTGAAACTCGCACCATCTTCTTCTGAAATCAGTGGAAATGGGAGAATTACAATGAGGAAGACTGCTGCCAAGCCCAAGCCAGCTTCCXC
TGGTGATTACGGATGGGACACTGCTGGGCTTTCAGCTGACCCTGAAACATTCGCTAAGAATCGTGAGTTGGAGGTTATTCATTGCAGATG
GGCCATGCTTGGTGCTCTTGGATGTGTTTTCCCCGAGCTTTTGGCACGTAACGGTGTTAAGTTTGGTGAAGCTGTATGGTTCAAAGCTGG
ATCTCAAATTTTCAGCGAGGGCGGACTTGACTACTTGGGAAACCCTAGTTTGGTTCATGCACAAAGCATTTTGGCTATTTGGGCTTGCCA
AGTTGTGTTGATGGGAGCTGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTTGGTGAGGTTGTTGACCCACTCTACCCTGGTGGTAGCTT
TGACCCATTGGGCCTTGCTGAAGACCCAGAGGCTTTTGCTGAGCTTAAAGTTAAGGAAATTAAGAATGGTAGACTTGCTATGTTCTCCAT
GTTTGGATTCTTTGTTCAAGCTATTGTCACCGGAAAGGGACCATTGGAGAACCTTGCTGACCCCCTTGCAGACCCAGTTAACAACAACGC
CTGGGCTTTTGCTACAAACTTTGTTCCCGGAAAGTGA(3')GTGCAACAAAATGTTGATCACTAATCTCCAATTAGTGTGAGATTAGGAG
TTTTTAGCTTTGTGAGGGATGAATCTATAGAAGGGGTCAGGTTTTTTAAAGCATTCTGGGTTATGGGTTCAGTACAAGATTATTGTAATG
TGGTGTATAAATTGGTTAGGGGTAATTAATGAAGAACAAGTTAATCTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan