Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U313230

Score 
614
Direction 
Forward
Predicted Peptide Sequence 
SAELIHIMAPTKVKIPTIDFSNEELKPNTPLWESTKIQLFEALQEYGCIEAILYDKNLNEIREGLFDFSKKLFEFPLETKMKNISEIQFH
IGYIGQIPHLPSYESLCIPNFLAPQSVENFANIFWPHGNPEFCNLVKSYANSLLKLDEMIKRMILENLGLEKHINELLDNFVLFRFTHYK
GTLSINKDENDKYDGLGAHTDNNFLTFIAQNQVNGLQINKNGEWINATISPNSFVVLSGDSFKAWTNGRLHSPLHRVAMPRENDRLSLQF
NTLSKPGHFIEAPKELVDEKHPLLFKPYEMHGLFNYVASNPGTPNAFQAYCGV
Predicted Coding Sequence 
XXATCGGCCGAATTGATTCACATTATGGCCCCTACAAAAGTTAAAATTCCCACCATAGATTTTTCTAATGAAGAACTAAAACCAAACACT
CCATTATGGGAATCCACAAAAATTCAACTTTTTGAAGCTTTACAAGAATATGGTTGTATTGAAGCAATATTATATGATAAAAATCTAAAT
GAAATAAGGGAGGGTTTATTTGATTTTTCAAAAAAATTATTTGAATTTCCCTTAGAGACCAAAATGAAAAATATTTCAGAAATACAATTT
CATATTGGCTACATAGGGCAAATTCCACACTTGCCATCTTATGAGAGTTTGTGTATTCCTAATTTCCTTGCTCCTCAAAGTGTTGAAAAT
TTTGCTAATATATTTTGGCCTCATGGTAATCCTGAATTCTGCAATTTGGTCAAATCTTATGCAAATTCACTTCTGAAATTGGATGAAATG
ATAAAAAGGATGATTTTGGAGAATTTGGGATTAGAAAAGCACATTAATGAATTATTGGATAATTTTGTCCTATTTAGATTTACCCATTAC
AAGGGAACATTATCTATTAATAAAGATGAAAATGATAAATACGATGGATTGGGTGCCCATACAGATAATAACTTCTTGACTTTTATAGCA
CAAAATCAAGTCAATGGATTGCAAATCAACAAAAATGGAGAGTGGATTAATGCCACTATTTCACCAAATTCTTTTGTTGTTCTGTCTGGT
GATTCCTTTAAAGCATGGACAAATGGTCGATTGCATTCTCCCCTCCATAGGGTAGCAATGCCTAGAGAAAATGATAGACTCTCCCTTCAA
TTTAATACATTATCAAAACCAGGTCATTTCATAGAGGCCCCAAAAGAACTAGTGGATGAAAAACACCCTTTACTCTTCAAGCCATATGAA
ATGCATGGATTATTTAACTATGTTGCTTCAAACCCTGGCACTCCTAATGCTTTCCAGGCTTATTGTGGTGTTTGA
Edits in Original Sequence 
(5')XXATCGGCCGAATTGATTCACATTATGGCCCCTACAAAAGTTAAAATTCCCACCATAGATTTTTCTAATGAAGAACTAAAACCAAA
CACTCCATTATGGGAATCCACAAAAATTCAACTTTTTGAAGCTTTACAAGAATATGGTTGTATTGAAGCAATATTATATGATAAAAATCT
AAATGAAATAAGGGAGGGTTTATTTGATTTTTCAAAAAAATTATTTGAATTTCCCTTAGAGACCAAAATGAAAAATATTTCAGAAATACA
ATTTCATATTGGCTACATAGGGCAAATTCCACACTTGCCATCTTATGAGAGTTTGTGTATTCCTAATTTCCTTGCTCCTCAAAGTGTTGA
AAATTTTGCTAATATATTTTGGCCTCATGGTAATCCTGAATTCTGCAATTTGGTCAAATCTTATGCAAATTCACTTCTGAAATTGGATGA
AATGATAAAAAGGATGATTTTGGAGAATTTGGGATTAGAAAAGCACATTAATGAATTATTGGATAATTTTGTCCTATTTAGATTTACCCA
TTACAAGGGAACATTATCTATTAATAAAGATGAAAATGATAAATACGATGGATTGGGTGCCCATACAGATAATAACTTCTTGACTTTTAT
AGCACAAAATCAAGTCAATGGATTGCAAATCAACAAAAATGGAGAGTGGATTAATGCCACTATTTCACCAAATTCTTTTGTTGTTCTGTC
TGGTGATTCCTTTAAAGCATGGACAAATGGTCGATTGCATTCTCCCCTCCATAGGGTAGCAATGCCTAGAGAAAATGATAGACTCTCCCT
TCAATTTAATACATTATCAAAACCAGGTCATTTCATAGAGGCCCCAAAAGAACTAGTGGATGAAAAACACCCTTTACTCTTCAAGCCATA
TGAAATGCATGGATTATTTAACTATGTTGCTTCAAACCCTGGCACTCCTAATGCTTTCCAGGCTTATTGTGGTGTTTGA(3')TATTATA
AAGTCAATTTTTTGATGAACATTTTTATCGGAGTATCGCTAGCATATATGGAATTTCTGATAAAAGATTCGTCGAAGATGTCTTGAACAA
GCCATCATTTCGTTTGGAATTTGTGTTTTTTTTTCCTAGTGTGTATCTTATGTTTGAATGGTTGTCGTTCTTTAGCTTTTGCGTTCTATG
TTTTATGTATAATGAAATAAAAAAAATGTGAATTTCTAATGAATGTTCCTGTCCGAATACCATTAATATATATGGGATTTCTGATAGAAT
GTTTGTAGAAATTCGTGTTTTTTTTAAATGGTGCTTATCTTATGTTTGAATTGTTATATTATTAAGTATTGACATTTTATGTATTATGTA
TGTGTAATTTCGATGGACATTCATGTTTTGTTTATTTTTTTTTAATGCAAATAATGAATTTTAAATGAACAATTTAATCAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan