ESTScan Details for Unigene SGN-U313283

Score 
2603
Direction 
Forward
Predicted Peptide Sequence 
MDDDFGIPPVEGMDEDMDLPEDSSTMKVGEEKEIGNQGLKKKLVKEGEGWETPEPGDEVEVHYTGTLLDGTKFDSSRDRGDPFKFTLGQG
QVIKGWDQGIKTMKKGENAIFTIPPELAYGESGSPPTIPPNATLQFDVELLSWVSVKDICKDGGIFKKILTEGEKWENPKDLDEVLVKYE
AQLENGTVVGKSDGVEFTVQDGHFCPALAKAVKTMKKGEKVQLTVKPQYGFGEKGKPASSDGGAVPPNATLQINLELVSWKTVSNVTDDK
KVVKKILKEGEGYERPNEGAVVKLKLVGKLLDGTVFTKKGHDGESEDNLFEFKTDEEQVIDGLDRAVMTMKKGEAALLTIAPEYAFGSSE
SKQDSAVVPPNSTVHYEVELVSFLKDKESWDMSTPEKIEAAGKKKEEGNALFKAGKYARASKRYEKAAKFIEYDTNFSEEEKKQSKALKI
TCNLNNAACKLKLKDYKQAEKLCTKVLELDSANVKALYRRAQAYMNMADLDLAEFDIKKALEIDPDNRDVKLEYKALKEKVKEINKKDAK
FYGNMFAKLNKQDSSNSANSAPKEPEPMSIDSKA
Predicted Coding Sequence 
ATGGACGATGATTTTGGTATTCCACCGGTCGAGGGAATGGACGAGGACATGGATCTGCCGGAGGACAGTTCGACCATGAAAGTAGGCGAG
GAGAAGGAAATTGGAAATCAGGGATTGAAGAAGAAGCTTGTTAAGGAAGGTGAAGGTTGGGAAACTCCTGAGCCTGGTGATGAAGTCGAA
GTTCATTATACTGGAACTCTGCTCGACGGAACCAAGTTTGATTCCAGCCGCGATAGAGGGGACCCCTTCAAGTTTACTCTCGGTCAAGGA
CAAGTAATTAAAGGATGGGATCAAGGTATAAAGACAATGAAGAAAGGTGAAAATGCTATTTTCACCATTCCTCCTGAGCTGGCTTACGGA
GAGAGTGGTTCTCCTCCAACTATCCCTCCAAATGCCACTCTACAATTTGATGTGGAGTTGCTATCATGGGTGAGTGTAAAAGACATTTGC
AAGGATGGTGGTATTTTCAAAAAGATCCTCACAGAGGGGGAAAAATGGGAAAATCCAAAAGATCTTGACGAAGTATTAGTCAAGTATGAA
GCTCAGCTCGAAAATGGCACAGTGGTGGGAAAATCAGATGGAGTGGAGTTCACTGTTCAAGATGGTCATTTTTGTCCTGCTCTTGCTAAG
GCTGTGAAAACTATGAAGAAAGGTGAAAAGGTCCAATTGACAGTGAAGCCACAATATGGCTTCGGAGAGAAAGGAAAACCAGCCTCGAGT
GATGGAGGAGCAGTTCCTCCTAATGCCACATTACAGATCAACTTGGAGTTGGTCTCCTGGAAAACTGTTTCAAATGTTACTGATGACAAG
AAAGTAGTAAAGAAGATCTTGAAAGAAGGGGAAGGATATGAGAGACCCAATGAAGGAGCTGTTGTTAAATTAAAACTGGTTGGCAAGCTG
CTAGATGGCACAGTCTTCACAAAGAAGGGCCATGATGGGGAAAGTGAAGATAATCTTTTTGAGTTTAAGACAGATGAGGAACAAGTAATT
GATGGGCTGGACAGAGCTGTCATGACAATGAAGAAGGGTGAAGCGGCGCTGCTTACAATTGCACCTGAATATGCCTTTGGTTCATCTGAG
TCGAAGCAAGATTCAGCTGTTGTTCCTCCTAATTCAACTGTGCATTATGAGGTTGAGCTTGTTTCTTTTCTCAAGGACAAGGAATCGTGG
GATATGAGTACCCCGGAGAAAATTGAGGCTGCTGGCAAAAAGAAAGAAGAAGGGAATGCACTGTTCAAGGCTGGTAAATACGCAAGGGCA
TCTAAGAGATATGAGAAGGCTGCTAAATTCATTGAGTATGATACTAACTTCAGTGAGGAGGAAAAGAAACAGTCTAAAGCATTGAAGATC
ACCTGCAACTTAAATAATGCAGCTTGCAAGTTGAAATTGAAAGATTACAAGCAGGCTGAGAAACTGTGTACCAAGGTGTTGGAACTGGAT
AGTGCAAATGTCAAAGCTCTTTACCGCAGAGCTCAAGCATATATGAACATGGCTGATCTTGATCTGGCTGAATTTGACATTAAGAAAGCT
CTTGAGATTGATCCTGACAACAGGGATGTGAAGCTTGAGTACAAAGCTCTAAAGGAGAAAGTCAAGGAAATTAACAAGAAGGACGCAAAG
TTCTACGGGAACATGTTTGCAAAGTTGAATAAGCAGGATTCATCAAACTCAGCCAACTCTGCTCCCAAGGAACCAGAGCCGATGAGCATT
GATAGCAAGGCATAA
Edits in Original Sequence 
CCCTTCGTCACGCTAAGGCTCTCTCAAAAACCTTGGAACACTCTAGAACCTAAACCCTTTCTTTTCACACTATCTGCACACCATTTAAGC
CTCCATCTTCTTCATCTCCAACACGCCATTATTTGCTTTCAGTGAGTTCGATTATATCAATCAATCAATCTTCTGCCTGTGTGTTCACAT
ATTGTGTTTGACGGAAAA
(5')ATGGACGATGATTTTGGTATTCCACCGGTCGAGGGAATGGACGAGGACATGGATCTGCCGGAGGACAG
TTCGACCATGAAAGTAGGCGAGGAGAAGGAAATTGGAAATCAGGGATTGAAGAAGAAGCTTGTTAAGGAAGGTGAAGGTTGGGAAACTCC
TGAGCCTGGTGATGAAGTCGAAGTTCATTATACTGGAACTCTGCTCGACGGAACCAAGTTTGATTCCAGCCGCGATAGAGGGGACCCCTT
CAAGTTTACTCTCGGTCAAGGACAAGTAATTAAAGGATGGGATCAAGGTATAAAGACAATGAAGAAAGGTGAAAATGCTATTTTCACCAT
TCCTCCTGAGCTGGCTTACGGAGAGAGTGGTTCTCCTCCAACTATCCCTCCAAATGCCACTCTACAATTTGATGTGGAGTTGCTATCATG
GGTGAGTGTAAAAGACATTTGCAAGGATGGTGGTATTTTCAAAAAGATCCTCACAGAGGGGGAAAAATGGGAAAATCCAAAAGATCTTGA
CGAAGTATTAGTCAAGTATGAAGCTCAGCTCGAAAATGGCACAGTGGTGGGAAAATCAGATGGAGTGGAGTTCACTGTTCAAGATGGTCA
TTTTTGTCCTGCTCTTGCTAAGGCTGTGAAAACTATGAAGAAAGGTGAAAAGGTCCAATTGACAGTGAAGCCACAATATGGCTTCGGAGA
GAAAGGAAAACCAGCCTCGAGTGATGGAGGAGCAGTTCCTCCTAATGCCACATTACAGATCAACTTGGAGTTGGTCTCCTGGAAAACTGT
TTCAAATGTTACTGATGACAAGAAAGTAGTAAAGAAGATCTTGAAAGAAGGGGAAGGATATGAGAGACCCAATGAAGGAGCTGTTGTTAA
ATTAAAACTGGTTGGCAAGCTGCTAGATGGCACAGTCTTCACAAAGAAGGGCCATGATGGGGAAAGTGAAGATAATCTTTTTGAGTTTAA
GACAGATGAGGAACAAGTAATTGATGGGCTGGACAGAGCTGTCATGACAATGAAGAAGGGTGAAGCGGCGCTGCTTACAATTGCACCTGA
ATATGCCTTTGGTTCATCTGAGTCGAAGCAAGATTCAGCTGTTGTTCCTCCTAATTCAACTGTGCATTATGAGGTTGAGCTTGTTTCTTT
TCTCAAGGACAAGGAATCGTGGGATATGAGTACCCCGGAGAAAATTGAGGCTGCTGGCAAAAAGAAAGAAGAAGGGAATGCACTGTTCAA
GGCTGGTAAATACGCAAGGGCATCTAAGAGATATGAGAAGGCTGCTAAATTCATTGAGTATGATACTAACTTCAGTGAGGAGGAAAAGAA
ACAGTCTAAAGCATTGAAGATCACCTGCAACTTAAATAATGCAGCTTGCAAGTTGAAATTGAAAGATTACAAGCAGGCTGAGAAACTGTG
TACCAAGGTGTTGGAACTGGATAGTGCAAATGTCAAAGCTCTTTACCGCAGAGCTCAAGCATATATGAACATGGCTGATCTTGATCTGGC
TGAATTTGACATTAAGAAAGCTCTTGAGATTGATCCTGACAACAGGGATGTGAAGCTTGAGTACAAAGCTCTAAAGGAGAAAGTCAAGGA
AATTAACAAGAAGGACGCAAAGTTCTACGGGAACATGTTTGCAAAGTTGAATAAGCAGGATTCATCAAACTCAGCCAACTCTGCTCCCAA
GGAACCAGAGCCGATGAGCATTGATAGCAAGGCATAA(3')CTTTAACTCAGACATGACATAAAAAGGATCAGCATCATCATTATCTTGA
CGGTTCATATATGCCATGGAGTCGTTATAGTTGGATTTTAGGAAAGAGTGTTTGCTGAATAATTTTACTGTAATTTCTGATTCTGCATTG
GGTACTATCAATGGATCCCTCTTGTAATGGAGTATCATCTGGCATCTTTGCTGTGACATATTTTGGTTATTGTGTTCTGTCATTTTGTTG
AGTGGAATTAATTGAATGTCGTTCGAAATTGATGTAAGCCAAAATCAGTAGTGAAGACCTTACAATAATAGTAGTAAAATTTTCTCAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan