ESTScan Details for Unigene SGN-U313286

Score 
1013
Direction 
Forward
Predicted Peptide Sequence 
GLWLMLGSDRLIAALATFTVLSSPIISVAIRDXNTCQRNSNGGGKNHGISQQHFNGFAPIERSITKAQQFQPLLQKRTGAKEASFHLQCN
LQSPDSDYEEGQPETLDYRVFFADNSGKKISPWHDIPLHLGDGVFNFVVEIPKESSAKMEVATDEQHTPIKQDTKKGKLRYYPYNIHWNY
GLLPQTWEDPTFANTEVEGALGDNDPVDVVEIGDSRGKIGQVLKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANRFALGNKPANKDYALKIITETNESWAKLVKRSIAAGELSLXIVINRALKPPACNLNWTWKMSP
Predicted Coding Sequence 
XGTGGACTGTGGTTGATGTTAGGCAGTGATAGGCTGATAGCAGCACTAGCAACTTTCACTGTTTTATCTTCTCCAATAATTTCTGTTGCC
ATTAGGGACXTGAACACTTGCCAGCGAAACAGCAATGGCGGCGGCAAGAATCATGGTATCAGCCAGCAACACTTTAACGGCTTCGCTCCT
ATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAGCCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCAGTGC
AATCTACAATCCCCAGATTCAGACTATGAAGAAGGACAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCAAAAAG
ATATCCCCTTGGCATGACATACCACTACATTTGGGTGATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAAAGATG
GAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACTGGAAC
TATGGATTGCTTCCTCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTAGGTGATAATGACCCTGTTGATGTT
GTTGAGATTGGGGATAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAGAACTT
GACTGGAAAATAGTTGCTATTTCACTAGATGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGGGCACT
CTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAGCAAAC
AAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTTCACTT
GXTATAGTGATTAATAGAGCTCTTAAGCCTCCTGCTTGTAACCTAAACTGGACATGGAAAATGTCCCCATGA
Edits in Original Sequence 
(5')XGTGGACTGTGGTTGATGTTAGGCAGTGATAGGCTGATAGCAGCACTAGCAACTTTCACTGTTTTATCTTCTCCAATAATTTCTGT
TGCCATTAGGGACXTGAACACTTGCCAGCGAAACAGCAATGGCGGCGGCAAGAATCATGGTATCAGCCAGCAACACTTTAACGGCTTCGC
TCCTATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAGCCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCA
GTGCAATCTACAATCCCCAGATTCAGACTATaGAAGAAGGACAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCA
AAAAGATATCCCCTTGGCATGACATACCACTACATTTGGGTGATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAA
AGATGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACT
GGAACTATGGATTGCTTCCTCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTAGGTGATAATGACCCTGTTG
ATGTTGTTGAGATTGGGGATAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAG
AACTTGACTGGAAAATAGTTGCTATTTCACTAGATGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGG
GCACTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAG
CAAACAAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTT
CACTTGXTATAGTGATTAATAGAGCTCTTAAGCCTCCTGCTTGTAACCTAAACTGGACATGGAAAATGTCCCCATGA(3')TTGTACTCT
TTCGTCTGGGGTGGAAGCCAATTCATATTTTAAAGAAAGACTTCTTTGTTATAAGCTACTGTTTTTCATTTATCATCAATAATTTTGTTC
ATCCAGTAGCATTTGTAAGTTATCCAGAACGAAAACAAGTGTATTGACATATGATTTAATCTTCATTCTCCAGATGCATCAATTGAAAAT
TAAAAAAAAAAAAAAAAAAAAAAAAANNCCCCGGGGGGGGGGCCGGGACCCCATTTCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan