ESTScan Details for Unigene SGN-U313287

Score 
981
Direction 
Forward
Predicted Peptide Sequence 
MAAIKELYNAWALNGFAPIERSITKAQQFQPLLQKRTGAKEASFHLQCNLQSPDSDYEEGQPETLDYRVFFADNSGKKISPWHDIPLHLG
DGVFNFVVEIPKESSAKMEVATDEQHTPIKQDTKKGKLRYYPYNIHWNYGLLPQTWEDPTFANTEVEGAFGDNDPVDVVEIGESRGKIGQ
VLKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVDDVEKHFPGTLTAIRDWFRDYKIPDGKPANRFALGNKPANKDYALKIITETN
ESWAKLVKRSIAAGELSLXINAD
Predicted Coding Sequence 
ATGGCGGCGATTAAAGAACTGTATAATGCATGGGCACTTAACGGCTTCGCTCCTATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAG
CCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCAGTGCAATCTACAATCCCCAGATTCAGACTATGAAGAAGGA
CAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCAAAAAGATATCCCCTTGGCATGACATACCACTACATTTGGGT
GATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAAAGATGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAA
CAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACTGGAACTATGGATTGCTTCCGCAAACATGGGAAGATCCTACT
TTTGCGAATACCGAAGTTGAAGGGGCATTTGGTGATAATGACCCTGTTGATGTTGTTGAGATTGGGGAAAGCCGAGGTAAAATTGGCCAG
GTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAGAACTTGACTGGAAAATAGTTGCTATTTCACTAGACGATCCA
AGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGGGCACTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAG
ATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAGCAAACAAGGATTACGCTCTTAAGATTATTACGGAAACCAAT
GAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTTCACTTGXTATAAATGCTGATTAA
Edits in Original Sequence 
TGGACTGTGGTTGATGTTAGGCAGAGATAGGCTGATAGCAGCACTATCAACTGTCACTGTTTAATCATCTCCACTAAAATCTGTCGCCAT
GAGGGACTGATCTCTTTCCAGCGAATCAAAC
(5')ATGGCGGcCGATTAAAGAACTGTATAATGCATGGGCACtTTAACGGCTTCGCTCC
TATCGAAAGGTCCATTACGAAGGCCCAACAATTTCAGCCTTTGCTTCAGAAACGGACCGGTGCAAAAGAAGCGTCTTTTCACTTGCAGTG
CAATCTACAATCCCCAGATTCAGACTATaGAAGAAGGACAGCCAGAAACCCTAGATTACCGCGTGTTTTTTGCAGACAATTCCGGCAAAA
AGATATCCCCTTGGCATGACATACCACTACATTTGGGTGATGGTGTTTTCAATTTTGTTGTTGAGATCCCCAAAGAATCAAGTGCAAAGA
TGGAAGTTGCTACAGATGAGCAACACACTCCTATTAAACAAGACACAAAGAAGGGGAAACTTCGATACTATCCATATAATATTCACTGGA
ACTATGGATTGCTTCCGCAAACATGGGAAGATCCTACTTTTGCGAATACCGAAGTTGAAGGGGCATTTGGTGATAATGACCCTGTTGATG
TTGTTGAGATTGGGGAAAGCCGAGGTAAAATTGGCCAGGTTCTGAAGGTCAAACCTTTAGCTGCTCTGGCAATGATTGATGAAGGAGAAC
TTGACTGGAAAATAGTTGCTATTTCACTAGACGATCCAAGAGCTTCACTTGTTAATGATGTTGATGATGTGGAAAAACATTTTCCGGGCA
CTCTCACAGCAATCAGGGACTGGTTTAGAGACTATAAGATACCTGATGGAAAACCTGCTAATAGGTTTGCTCTTGGCAACAAGCCAGCAA
ACAAGGATTACGCTCTTAAGATTATTACGGAAACCAATGAATCTTGGGCAAAGCTGGTCAAGAGATCAATCGCTGCTGGTGAGCTTTCAC
TTGXTATAAATGCTGATTAA(3')TAGAGAGCTTAAGCTGGCTAGTTCTCCTGCCTGTAACCTAAACTGGACATGGAAATTGTCCCCATG
ATTGTACTCTTTCGTCTGGGGTGGAAGCCAATTCATATTTTTAAGATGACTTCTTGTTATAAGCTACTGTTTTTCCTTTATCATCAATAA
TTTTGTTCATCCAGTAGCGTCTGTAAGTTATCCAGAACGAAACAGGTGTATTGAACTATTGATATATGATTTGATCTTCATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan