ESTScan Details for Unigene SGN-U313450

Score 
1050
Direction 
Forward
Predicted Peptide Sequence 
MASIALKTFIGLRQSSPENNSIKISKSLPTNHTHRRLRINASKSSPRVTGRNLRVAVIGGGPAGGAAAETLAKGGIETFLIERKMDNCKP
CGGAIPLCMVGEFDLPLDIIDRKVTKMKMISPSNVAVDIGQTLKPHEYIGWCAAKYSMPTSGTXAAEAGASVLNGLFLRMDMPKAPNSPY
VLHYTSYDSKTNGAGEKCTLEVDAVIGADGANSRVAKSINAGDYEYAIAFQERIRISDDKMKYYENLAEMYVGDDVSPDFYGWVFPKCDH
VAVGTGTVTHKADIKKFQLATRLRADSKITGGKIIRVEAHPIPEHPRPRRLQDRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEG
SENGKRMVDESDLRKYLEKWDKTYWPTYKVLDILQKVFYRSNPAREAFVEMCADEYVQKMTFDSYLYKKVAPGNPIEDLKLAVNTIGSLV
RANALRREMDKLSV
Predicted Coding Sequence 
ATGGCTTCAATTGCTCTCAAAACTTTCATCGGCCTCCGTCAATCCTCGCCGGAAAACAACTCTATTAAAATCTCTAAATCCCTCCCTACC
AACCACACCCACCGTAGGCTACGTATCAATGCTTCGAAGTCCAGCCCAAGAGTCACCGGCAGAAACCTTCGCGTTGCGGTGATTGGTGGT
GGTCCTGCTGGTGGCGCCGCTGCAGAGACGCTCGCTAAGGGTGGAATTGAGACCTTTTTGATAGAACGCAAGATGGACAACTGCAAACCC
TGCGGTGGTGCCATCCCACTCTGCATGGTGGGCGAATTCGATCTACCTCTCGATATCATCGATCGGAAAGTTACCAAGATGAAGATGATT
TCCCCATCCAACGTCGCCGTCGATATCGGACAGACTCTGAAGCCTCACGAGTATATCGGATGGTGCGCCGCGAAGTACTCGATGCCTACC
TCCGGGACCGXTGCTGCTGAAGCCGGAGCTTCTGTTCTCAACGGCTTGTTTCTCAGAATGGACATGCCAAAAGCCCCAAATTCACCATAC
GTCCTACACTACACATCTTACGATTCCAAAACTAACGGCGCCGGTGAGAAGTGCACCCTGGAAGTTGACGCCGTTATCGGCGCAGACGGC
GCAAATTCCCGTGTCGCAAAATCCATCAACGCTGGGGACTACGAGTACGCCATTGCCTTCCAGGAACGAATTAGAATTTCCGATGATAAA
ATGAAGTACTACGAGAATTTAGCTGAAATGTATGTCGGCGATGACGTATCCCCTGATTTTTACGGTTGGGTTTTCCCTAAATGTGACCAC
GTTGCCGTCGGCACAGGCACCGTTACCCACAAAGCAGACATTAAGAAATTCCAGCTAGCCACAAGACTGAGAGCCGATTCCAAAATCACC
GGCGGAAAAATCATCCGAGTTGAGGCTCATCCAATTCCAGAACACCCAAGGCCAAGAAGATTACAAGACAGAGTCGCATTAGTTGGGGAT
GCAGCAGGATACGTGACGAAATGTTCAGGCGAAGGGATCTACTTCGCGGCGAAGAGTGGACGTATGTGTGCTGAAGCAATTGTTGAAGGA
TCAGAAAATGGGAAGAGAATGGTGGACGAGAGTGATTTGAGGAAGTACTTGGAGAAATGGGACAAGACTTACTGGCCAACATACAAGGTG
CTTGATATCTTGCAGAAGGTATTTTACAGGTCGAATCCAGCAAGAGAAGCTTTCGTGGAGATGTGCGCTGATGAGTATGTGCAGAAGATG
ACATTCGACAGCTATTTGTACAAGAAAGTTGCACCAGGAAACCCCATTGAAGACTTGAAGCTTGCTGTGAATACCATTGGAAGTTTGGTG
AGGGCTAATGCACTAAGAAGGGAAATGGACAAACTCAGTGTATAA
Edits in Original Sequence 
TCGGCCGAATTGACACACTACACAACC(5')ATGGCTTCAATTGCTCTCAAAACTTTCATCGGCCTCCGTCAATCCTCGCCGGAAAACAA
CTCTATTAAAATCTCTAAATCCCTCCCTACCAACCACACCCACCGTAGGCTACGTATCAATGCTTCGAAGTCCAGCCCAAGAGTCACCGG
CAGAAACCTTCGCGTTGCGGTGATTGGTGGTGGTCCTGCTGGTGGCGCCGCTGCAGAGACGCTCGCTAAGGGTGGAATTGAGACCTTTTT
GATAGAACGCAAGATGGACAACTGCAAACCCTGCGGTGGTGCCATCCCACTCTGCATGGTGGGCGAATTCGATCTACCTCTCGATATCAT
CGATCGGAAAGTTACCAAGATGAAGATGATTTCCCCATCCAACGTCGCCGTCGATATCGGACAGACTCTGAAGCCTCACGAGTATATCGG
tATGGTGCGCCGCGAAGTACTCGATGCCTACCTCCGGGACCGXTGCTGCTGAAGCCGGAGCTTCTGTTCTCAACGGCTTGTTTCTCAGAA
TGGACATGCCAAAAGCCCCAAATTCACCATACGTCCTACACTACACATCTTACGATTCCAAAACTAACGGCGCCGGTGAGAAGTGCACCC
TGGAAGTTGACGCCGTTATCGGCGCAGACGGCGCAAATTCCCGTGTCGCAAAATCCATCAACGCTGGGGACTACGAGTACGCCATTGCCT
TCCAGGAACGAATTAGAATTTCCGATGATAAAATGAAGTACTACGAGAATTTAGCTGAAATGTATGTCGGCGATGACGTATCCCCTGATT
TTTACGGTTGGGTTTTCCCTAAATGTGACCACGTTGCCGTCGGCACAGGCACCGTTACCCACAAAGCAGACATTAAGAAATTCCAGCTAG
CCACAAGACTGAGAGCCGATTCCAAAATCACCGGCGGAAAAATCATCCGAGTTGAGGCTCATCCAATTCCAGAACACCCAAGGCCAAGAA
GATTACAAGACAGAGTCGCATTAGTTGGGGATGCAGCAGGATACGTGACGAAATGTTCAGGCGAAGGGATCTACTTCGCGGCGAAGAGTG
GACGTATGTGTGCTGAAGCAATTGTTGAAGGATCAGAAAATGGGAAGAGAATGGTGGACGAGAGTGATTTGAGGAAGTACTTGGAGAAAT
GGGACAAGACTTACTGGCCAACATACAAGGTGCTTGATATCTTGCAGAAGGTATTTTACAGGTCGAATCCAGCAAGAGAAGCTTTCGTGG
AGATGTGCGCTGATGAGTATGTGCAGAAGATGACATTCGACAGCTATTTGTACAAGAAAGTTGCACCAGGAAACCCCATTGAAGACTTGA
AGCTTGCTGTGAATACCATTGGAAGTTTGGTGAGGGCTAATGCACTAAGAAGGGAAATGGACAAACTCAGTGTATAA(3')GAAGAGGAT
AAAATTTCATAGTAGCTAATATTTTGTAAACTTGATTTGTAATTGAAGTATTTATGCCTTTTATCGAATTTCAAAAAAAAAAAAAAAAAA
TTCCTGTCAATGTTGTTGAAGCTAGTTTAAACTTCGAATTTGGACTAAACTTCTAAAGCTTAGATAAGTGAATAATGAGATTGTACTGAT
ATATGATTTTATACAGGAAACAAAGATTAATTTTTTTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan