ESTScan Details for Unigene SGN-U313483

Score 
707
Direction 
Forward
Predicted Peptide Sequence 
MGGSCFLVLLLQIIVTQVVGVGVGVGVGVGVGVGPGGVWFGGGINSPNPGAVPSQSSAYTALQAWKSAITDDPSGILKNWVGPNVCSYKG
IFCSNSQDYMGNPTDPVVTDFQXIIPQTFRDLSSLVELDLSNNHFSGPFPTTVLFIPNLLYLDLRFNSFTGPIPEDLFNRKLDAIFLNNN
QFDGELPQSLGNSPASVINFANNKFTGNIPFSLGDMGPRIKEILFFNNELNGCIPEGVGLWTDL
Predicted Coding Sequence 
ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTGGTGTTGGCGTTGGCGTTGGT
GTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAAGTCAAAGTTCAGCATACACT
GCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAAATGTGTGTAGTTACAAAGGA
ATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTATAATTCCACAAACATTCAGA
GATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTACTATTCATCCCAAATCTTCTT
TATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATGCTATTTTTCTTAATAATAAC
CAGTTTGATGGTGAACTACCTCAAAGTTTAGGGAATTCCCCTGCTTCAGTCATTAATTTTGCTAATAATAAGTTTACTGGCAACATTCCT
TTTAGTTTAGGGGACATGGGTCCGAGAATTAAGGAGATTTTGTTCTTTAACAATGAGTTAAATGGTTGTATACCAGAAGGTGTGGGATTA
TGGACGGATTTG
Edits in Original Sequence 
GAAGAAGCAGCACCAACTAAACCCACATCGTCTCTCATCAATGCTACAATCACATTTTGTGCAACCTTGCAAAAAAAAGAAAAGACTCTT
GTTTGATCAAAA
(5')ATGGGGGGAAGTTGCTTTCTGGTTTTGCTTCTTCAAATCATAGTTACTCAAGTTGTTGGTGTTGGTGTTGGTGT
TGGCGTTGGCGTTGGTGTTGGTGTTGGACCTGGAGGTGTTTGGTTTGGTGGAGGGATCAACAGCCCAAACCCAGGAGCTGTCCCAAGTCA
AAGTTCAGCATACACTGCTCTTCAAGCATGGAAATCTGCAATTACTGATGATCCATCGGGGATTTTGAAGAATTGGGTGGGTCCAAATGT
GTGTAGTTACAAAGGAATTTTCTGCTCAAACTCTCAAGATTACATGGGCAACCCAACAGACCCAGTTGTTACAGATTTTCAGGXTATAAT
TCCACAAACATTCAGAGATCTGTCTTCACTCGTTGAATTAGACCTTAGTAACAACCATTTCTCAGGTCCATTCCCTACTACAGTACTATT
CATCCCAAATCTTCTTTATTTAGATCTCAGATTCAACAGTTTCACAGGCCCAATTCCCGAGGATCTGTTCAACAGAAAACTTGATGCTAT
TTTTCTTAATAATAACCAGTTTGATGGTGAACTACCTCAAAGTTTAGGGAATTCCCCTGCTTCAGTCATTAATTTTGCTAATAATAAGTT
TACTGGCAACATTCCTTTTAGTTTAGGGGACATGGGTCCGAGAATTAAGGAGATTTTGTTCTTTAACAATGAGTTAAATGGTTGTATACC
AGAAGGTGTGGGATTATGGACGGATTTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan