ESTScan Details for Unigene SGN-U313509

Score 
383
Direction 
Forward
Predicted Peptide Sequence 
MEGKNMLKLSHVLAFLLLASLFQSLMARDLISDGIEVVKFPVEDDGEFVFCPGKLSWPELVGKSAGYAKEVIQKENPIVHDVRLLFPGMI
RPLNYVCGRVFLVVNFKRIVRVTPSMG
Predicted Coding Sequence 
ATGGAGGGAAAGAATATGCTCAAGTTATCTCATGTGCTTGCTTTCTTGCTTCTTGCATCACTTTTTCAATCACTGATGGCAAGAGATTTG
ATCAGTGATGGCATAGAAGTAGTGAAATTTCCAGTGGAAGATGATGGAGAATTTGTATTTTGCCCAGGTAAGCTATCATGGCCTGAACTT
GTTGGGAAATCAGCAGGATATGCAAAAGAAGTAATTCAAAAGGAAAATCCCATAGTTCATGATGTTAGGCTTCTATTTCCTGGTATGATT
AGGCCACTTAATTATGTTTGTGGCAGAGTTTTTCTGGTTGTTAACTTTAAACGCATTGTTCGAGTTACTCCCTCTATGGGTTAG
Edits in Original Sequence 
TTAAATAAAAGCAAA(5')ATGGAGGGAAAGAATATGCTCAAGTTATCTCATGTGCTTGCTTTCTTGCTTCTTGCATCACTTTTTCAATC
ACTGATGGCAAGAGATTTGATCAGTGATGGCATAGAAGTAGTGAAATTTCCAGTGGAAGATGATGGAGAATTTGTATTTTGCCCAGGTAA
GCTATCATGGCCTGAACTTGTTGGGAAATCAGCAGGATATGCAAAAGAAGTAATTCAAAAGGAAAATCCCATAGTTCATGATGTTAGGCT
TCTATTTCCTGGTATGATTAGGCCACTTAATTATGTTTGTGGCAGAGTTTTTCTGGTTGTTAACTTTAAACGCATTGTTCGAGTTACTCC
CTCTATGGGTTAG(3')TAACATTATTCTCATTATTATGTTATTATGAAAATTAAATAAAGTGGAGATATTAAATATAATGTCTTCATGT
ACTCTACTATTTCAGCATAAATAAAACTAATGTGTTATTTTCTTTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan