ESTScan Details for Unigene SGN-U313687

Score 
334
Direction 
Forward
Predicted Peptide Sequence 
YKKNNXGQLIGESNSQLAVNRKISTFPLKPLFNYRFALFASLIHRSSDQPLIGVFKLSIFVPFMFKGNNKEEVDIWMKKGITPQHCNHED
RLKEHVTQYRIIDMEADQQGQEFFHSAPCMFYGSIAALPQPTVHAVVPAPVNAGNIYLHHVSDHQEGPLTYGLTQFNGIQHQHPASNPDL
AISASNHYNPYMAVPSASGDFPIPVNHGPLDRLHTSSHNIFGMNFRYGRDNHYMDDVRGSYXEKDAEGIXANLHIIMLWQX
Predicted Coding Sequence 
XXTTACAAGAAAAATAACXGTGGCCAATTAATAGGAGAATCAAACAGCCAATTAGCAGTTAACCGTAAAATTTCCACTTTTCCATTGAAA
CCTCTCTTCAATTATCGCTTTGCCCTTTTTGCTTCTTTGATCCATCGATCGTCTGATCAACCTTTAATTGGTGTTTTTAAACTGAGCATT
TTTGTGCCTTTTATGTTTAAAGGCAACAACAAGGAAGAAGTTGATATTTGGATGAAAAAAGGAATCACCCCACAACATTGTAACCACGAA
GATAGGCTAAAGGAGCATGTCACACAGTATCGCATAATTGATATGGAAGCAGATCAGCAAGGTCAAGAGTTTTTTCATTCAGCACCTTGC
ATGTTTTACGGGAGCATAGCGGCTTTACCACAGCCTACTGTCCATGCAGTAGTACCAGCTCCCGTAAATGCTGGTAATATATATTTGCAC
CATGTATCAGATCATCAAGAGGGTCCCTTAACGTATGGCTTGACACAGTTCAATGGGATTCAACATCAGCATCCTGCCAGCAATCCTGAC
CTAGCTATTTCTGCTTCAAATCATTACAATCCTTACATGGCTGTTCCATCCGCTTCTGGAGATTTCCCTATTCCAGTAAATCACGGGCCA
CTTGATCGGCTTCATACAAGTTCTCACAACATCTTTGGAATGAATTTCAGATACGGAAGGGACAATCATTATATGGACGATGTCAGAGGC
TCATATAXAGAGAAAGATGCTGAAGGAATTNCTGCAAATCTTCATATCATCATGCTTTGGCAGGXX
Edits in Original Sequence 
(5')XXTTACAAGAAAAATAACXGTGGCCAATTAATAGGAGAATCAAACAGCCAATTAGCAGTTAACCGTAAAATTTCCACTTTTCCATT
GAAACCTCTCTTCAATTATCGCTTTGCCCTTTTTGCTTCTTTGATCCATCGATCGTCTGATCAACCTTTAATTGGTGTTTTTAAACTGAG
CATTTTTGTGCCTTTTATGTTTAAAGGCAACAAtCAAGGAAGAAGTTGATATTTGGATGAtAAAAAGGAATCACCCCACAACATTGTAAC
CACGAAGATAGGCTAAAGGAGCATGTCACACAGTaATCGCATAATTGATATGGAAGCAGATCAGCAAGGTCAAGAGTTTTTTCATTCAGC
ACCTTGCATGTTTTACGGGAGCATAGCGGCTTTACCACAGCCTACTGTCCATGCAGTAGTACCAGCTCCCGTAAATGCTGGTAATATATA
TTTGCACCATGTATCAGATCATCAAGAGGGTCCCTTAACGTATGGCTTGACACAGTTCAATGGGATTCAACATCAGCATCCTGCCAGCAA
TCCTGACCTAGCTATTTCTGCTTCAAATCATTACAATCCTTACATGGCTGTTCCATCCGCTTCTGGAGATTTCCCTATTCCAGTAAATCA
CGGGCCACTTGATCGGCTTCATACAAGTTCTCACAACATCTTTGGAATGAATTTCAGATACGGAAGGGACAATCATTATATGGACGATGT
CAGAGGCTCATATAXAGAGAAAGATGCTGAAGGAATTNCTGCAAATCTTCATATCATCATGCTTTGGCAGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan