ESTScan Details for Unigene SGN-U313759

Score 
2379
Direction 
Forward
Predicted Peptide Sequence 
MASRSSIRLISYSNEIINGEPIYISSNCYPIKAHKYEPAGLAFHSAALRLIGHVEKEDPKDGKEDVPNDKEQTFAYSSESYSSKGKKKSS
TGEKVQDHYALLGLSNLRYLASEDQIRKSYRDAALRHHPDKLASLLLAEETEAAKQAKKEEIENHFKAIQEAYEVLMDPVRRRIYDSTDE
FDDEIPTECAPQDFFKVFGPAFLRNGRWSVTQPIPSLGDENTPIKEVDSFYNFWYSFKSWREFPHADEFDLEQAESRDHKRWMERQNAKL
SEKARKEETARVRTLVDNAYRKDPRILGRKEAEKAEKQRKKDAKLLAKKLQEAEAIRIVEEDKRKKEEEEKRAAEVALQQKKLKEKEKKL
LRKERSRLRTLAAPVLSQRLLGLNDDDVEGLCMSLDIEQLRNLCDKADGQGEIVIAELLRGALGHEHNLKYENKDEKIKSQQNGSLDSKK
QVPLMSSEKKEKPWSKEEIDLLRKGMLKYPKGTSRRWEVISDYIGTARTVEEILKATKTVLLQKPDSAKAFDSFLEKRKPAPTIVSPLST
RAEVEGVENSSKPESGSAKVADSQETPSQNTNSQNTEDAPTANGVSSSSDSDVWSAVQEKALVQALKTFPKETSQRWERVATAVPGKTMN
QCKKKFXITQREFQEQEKCSVRLVVLETAESSFFLLFLFSIVQAAXNKLTLVMHCDNTPHPSPFSVPFLSLSSSIYISTIQYGIVKLLYL
NTVIFDGKH
Predicted Coding Sequence 
ATGGCTTCCAGGAGTAGCATCCGTCTTATTTCATACTCGAATGAGATTATAAATGGTGAACCAATCTATATTTCCTCTAACTGCTATCCT
ATTAAAGCTCACAAATATGAGCCTGCTGGGCTTGCTTTTCACTCTGCTGCTCTTAGACTAATTGGGCATGTTGAGAAAGAAGACCCCAAA
GATGGCAAAGAAGATGTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGGGAAGAAGAAGTCTTCT
ACCGGCGAAAAGGTACAAGATCATTATGCATTATTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCAGATAAGGAAGAGCTAT
CGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAAACAAGCCAAGAAGGAG
GAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGGAGAAGGATTTATGACTCCACGGATGAA
TTTGATGATGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTTTTAAGGAATGGTCGTTGGTCCGTC
ACCCAACCCATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTACAGCTTCAAAAGTTGG
AGAGAGTTCCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAGGCAGAATGCAAAACTT
TCAGAGAAAGCCAGAAAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTATAGAAAAGACCCTAGAATCTTAGGAAGAAAA
GAGGCGGAGAAAGCAGAGAAGCAGAGAAAGAAGGACGCTAAACTACTTGCAAAGAAATTACAGGAGGCAGAAGCAATTAGGATTGTTGAA
GAGGACAAGCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTG
TTGCGAAAAGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCAGCGTTTGCTTGGGCTAAATGATGACGATGTAGAAGGT
CTATGCATGTCACTTGACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGACAGGGTGAGATTGTTATTGCTGAACTTCTTAGG
GGGGCACTTGGACATGAACACAACCTGAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTCTCTGGACAGTAAAAAA
CAAGTTCCTCTGATGAGCAGTGAGAAAAAAGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGGGATGCTGAAATATCCT
AAAGGAACTTCTCGAAGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAAGGCTACAAAAACAGTT
CTGCTCCAGAAGCCCGACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCTGCACCAACTATTGTTTCTCCTCTTTCCACG
AGGGCAGAAGTAGAGGGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGCGCCAAAGTAGCTGATTCTCAGGAGACCCCTAGTCAAAAC
ACAAACAGCCAGAACACTGAGGATGCACCTACAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACGTATGGTCTGCTGTTCAAGAAAAA
GCCTTAGTTCAAGCTCTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTGGCAACTGCTGTCCCTGGGAAGACTATGAAC
CAGTGTAAAAAAAAGTTTGXCATTACTCAAAGAGAATTTCAGGAGCAAGAAAAGTGCAGTGTGAGGTTAGTGGTGCTTGAAACTGCTGAG
TCTAGTTTTTTTCTTTTATTTCTATTTTCTATTGTTCAGGCAGCCXGCAACAAGCTCACTCTTGTAATGCATTGTGACAACACCCCACAC
CCCAGTCCATTTTCAGTACCATTTTTGTCATTAAGCAGTAGCATTTACATATCTACTATTCAGTACGGCATTGTGAAGTTACTATACTTG
AATACAGTAATATTTGATGGGAAACACTGA
Edits in Original Sequence 
CGGCCGAATTGCTCTTTTAGCTGCCCCTATGCAGCTGAGTTCCGCAGACTAAAACCCTAGCTCCTCCCTCTCCTTCAACCGTCGTCACGC
CGCTCTCTTTTCGTAAACACATAACTTTTAACCCCCTTTTTTAGATCATCCTCCATAATCAGTAACACAATTAGATTATCGGAAAAGGCT
TGGAGAGTGTAGAAGGCTGCTTTTATTGGCTCTTGCCCCAAGTGTAGCTGTTGGTGGATGCGTTCTTATTCATCTTCTATAGTTGAGGGC
TAAGTTTTCTCT
(5')ATGGCTTCCAGGAGTAGCATCCGTCTTATTTCATACTCGAATGAGATTATAAATGGTGAACCAATCTATATTTC
CTCTAACTGCTATCCTATTAAAGCTCACAAATATGAGCCTGCTGGGCTTGCTTTTCACTCTGCTGCTCTTAGACTAATTGGGCATGTTGA
GAAAGAAGACCCCAAAGATGGCAAAGAAGATGTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGG
GAAGAAGAAGTCTTCTACCGGCGAAAAGGTACAAGATCATTATGCATTATTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCA
GATAAGGAAGAGCTATCGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAA
ACAAGCCAAGAAGGAGGAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGGAGAAGGATTTA
TGACTCCACGGATGAATTTGATGATGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCATTTTTAAGGAA
TGGTCGTTGGTCCGTCACCCAACCCATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTA
CAGCTTCAAAAGTTGGAGAGAGTTCCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAG
GCAGAATGCAAAACTTTCAGAGAAAGCCAGAAAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTATAGAAAAGACCCTAG
AATCTTAGGAAGAAAAGAGGCGGAGAAAGCAGAGAAGCAGAGAAAGAAGGACGCTAAACTACTTGCAAAGAAATTACAGGAGGCAGAAGC
AATTAGGATTGTTGAAGAGGACAAGCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGA
GAAAGAAAAGAAATTGTTGCGAAAAGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCAGCGTTTGCTTGGGCTAAATGA
TGACGATGTAGAAGGTCTATGCATGTCACTTGACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGACAGGGTGAGATTGTTAT
TGCTGAACTTCTTAGGGGGGCACTTGGACATGAACACAACCTGAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTC
TCTGGACAGTAAAAAACAAGTTCCTCTGATGAGCAGTGAGAAAAAAGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGG
GATGCTGAAATATCCTAAAGGAACTTCTCGAAGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAA
GGCTACAAAAACAGTTCTGCTCCAGAAGCCCGACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCTGCACCAACTATTGT
TTCTCCTCTTTCCACGAGGGCAGAAGTAGAGGGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGCGCCAAAGTAGCTGATTCTCAGGA
GACCCCTAGTCAAAACACAAACAGCCAGAACACTGAGGATGCACCTACAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACGTATGGTC
TGCTGTTCAAGAAAAAGCCTTAGTTCAAGCTCTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTGGCAACTGCTGTCCC
TGGGAAGACTATGAACCAGTGTAAAAAAAAGTTTGXCATTACTCAAAGAGAATTTCAGGAGCAAGAAAAGTGCAGTGTGAGGTTAGTGGT
GCTTGAAACTGCTGAGTCTAGTTTTTTTCTTTTATTTCTATTTTCTATTGTTCAGGCAGCCXGCAACAAGCTCACTCTTGTAATGCATTG
TGACAACACCCCACACCCCAGTCCATTTTCAGTACCATTTTTGTCATTAAGCAGTAGCATTTACATATCTACTATTCAGTACGGCATTGT
GAAGTTACTATACTTGAATACAGTAATATTTGATGGGAAACACTGA(3')TGATATCTAAAAAAAAAAAAAAAAAAATTTAAAAAAAAAA
AAAAAANTCCGGGGGGGGGGGCCGGGCCCCCATTCCCCCTAAGGGGGGGGTAAATAAAATTTCGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan