ESTScan Details for Unigene SGN-U313841

Score 
234
Direction 
Forward
Predicted Peptide Sequence 
MSVVSSLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYD
VASK
Predicted Coding Sequence 
ATGTCGGTGGTATCGTCATTAGCAAAGTATAAGCTGGTGTTTTTGGGAGATCAATCTGTGGGCAAAACCAGTATAATTACTCGTTTTATG
TACGATAAATTTGACACCACTTATCAGGCTACGATTGGTATTGATTTTTTATCAAAGACAATGTACCTTGAAGATCGAACAGTTCGCCTG
CAGCTCTGGGATACTGCTGGTCAAGAAAGATTTAGAAGTCTTATTCCAAGCTACATTAGAGATTCTTCTGTTGCTGTAATTGTATATGAT
GTTGCCAGTAAGTGA
Edits in Original Sequence 
GCGGTTAGTGGTATTATATATATAGAGAGAATTCGAAGAGAGGCAGAGAAGTGTTTTATCTTCCTTAATTTTCTCTTTCCACCCATTCAG
ATCTGAGAGAGAGAAATTGTATTTTGAAGAAGAAAGAAAAAGAAAGGGTAATTCAATAGAATTTTGGTTCCA
(5')ATGTCGGTGGTATC
GTCATTAGCAAAGTATAAGCTGGTGTTTTTGGGAGATCAATCTGTGGGCAAAACCAGTATAATTACTCGTTTTATGTACGATAAATTTGA
CACCACTTATCAGGCTACGATTGGTATTGATTTTTTATCAAAGACAATGTACCTTGAAGATCGAACAGTTCGCCTGCAGCTCTGGGATAC
TGCTGGTCAAGAAAGATTTAGAAGTCTTATTCCAAGCTACATTAGAGATTCTTCTGTTGCTGTAATTGTATATGATGTTGCCAGTAAGTG
A(3')TTGCTTGATATTCTTCCCACAGAATGTTTCGACGCATATTTGTGCCCTACTCAATATTTGGTCATACTACAAGGTTCCTAGGGAG
CCTATAGCAATTGATTCTCTATAATTAGTTTTTTTTTTGTTTTTCTATAATTAGTTTGATTATTCATTTCTTTGGTTTAATGTTCAATGA
ACAAAGTTTTGGTGATAAATCATTATATCTGCAGACCGCCAATCATTTCTGAACACTTCAAAATGGATCGAAGAAGTACGCACTGAACGA
GGCAGTGATGTCATTATTGTTCTTGTTGGGACAAAACTGATCTTGTTGAGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan