ESTScan Details for Unigene SGN-U314116

Score 
369
Direction 
Forward
Predicted Peptide Sequence 
MAGKMSIVLFVLLVVFLTQNQVSRANIMRDEQQQQQRNNQLMVLVREDSILKIVNQNARTGXSKTSYKKPCMFFCQKCCAKCLCVPAGTM
AISKVALATITGRPKEVAQSAHDHPYCIKM
Predicted Coding Sequence 
ATGGCTGGGAAAATGAGCATTGTCTTGTTTGTTCTTTTGGTGGTTTTCCTGACTCAAAATCAGGTTTCAAGGGCCAACATTATGCGTGAT
GAGCAGCAGCAACAACAGAGAAATAACCAACTGATGGTGTTAGTGAGGGAAGACTCCATCCTCAAGATTGTCAACCAAAATGCACGTACC
GGTGXTTCAAAGACATCGTATAAGAAGCCGTGTATGTTTTTCTGCCAGAAATGCTGTGCAAAGTGTTTGTGTGTTCCTGCTGGTACCATG
GCAATAAGCAAAGTTGCCCTTGCTACAATAACTGGAAGACCAAAAGAGGTGGCCCAAAGTGCCCATGATCATCCATATTGTATTAAAATG
TGA
Edits in Original Sequence 
TTAATGTATACTTTTTAGATTATGCTATGTATGGCTTTTGAACTGAACTATGAGAAAAAAATTGACTTGAAACGAACAAAAAGGGCAAAA
AACTTCTTACACTATGCGAAATTGAAATAAAATGCTCCGGTTAATAGTTTGGTCCAAAAATATTGATGCAGTTAATAGATTTTGGACCAA
ACTATCGATGCTGTGTATAGATTTATTCAATTTTGCATAGGGGATACTGTTGGAGTGTGACAACAGCAAGTGCTAGGCTAAAGAGATTAA
CCACTTGAGAAGATCCCTCTCTATAAATAGAAGTCGATTCTCTCAAAGCTCTACACACTTCACTTCCTCTCTTAGCTTCACACAAAATTA
CTACA
(5')ATGGCTGGGAAAATGAGCATTGTCTTGTTTGTTCTTTTGGTGGTTTTCCTGACTCAAAATCAGGTTTCAAGGGCCAACATT
ATGCGTGATGAGCAGCAGCAACAACAGAGAAATAACCAACTGtATGGTGTTAGTGAGGGAAGACTCCATCCTCAAGATTGTCAACCAAAA
TGCACGTACCGGTGXTTCAAAGACATCGTATAAGAAGCCGTGTATGTTTTTCTGCCAGAAATGCTGTGCAAAGTGTTTGTGTGTTCCTGC
TGGTACCtATGGCAATAAGCAAAGTTGCCCTTGCTACAATAACTGGAAGACCAAAAGAGGTGGCCCAAAGTGCCCATGATCATCCATATT
GTATTAAAATGTGA(3')CTGCAGACACCCAACTTCTGTCAAATCTAGTAGTATTAATTAATTAATCAACACTTGTTGTCTCAAGTGGTG
TATTAGCTAGTAATGTTAGGTCCCAATTATATAGAAGAAGATTGGGCTAGCTACAAGTACAATAGCATGGTTATGATTATGCAGCTTTTT
TTGTGAGACTTATTTTATATTATTATTATGATTATATCTTAAGTGATATTTATTGGTGTACCATAAGAATTATAGAATGTTCAAGTCATC
TAATCCAAGGCCAACTTGGCGTTTGAATGGGCTATTATACTAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan