ESTScan Details for Unigene SGN-U314191

Score 
1532
Direction 
Forward
Predicted Peptide Sequence 
MKALLSSTTLQLKPLHPPSSFSSLHSPFSSISVLRVKGSKKAETFIQRSKFSTVLPLKALNPVDFKRRLGKFKATDSPLPTVPGYDVAGV
VVKVGSQVKGLKEGDEVYGDIHEKALDGPKQFGSLAEYTAVEEKLVALKPKNLSFAEAAALPLAIETAYEGLEKAGFSSGKSVLVLGGAG
GVGSLVIQLAKHVFGASKVAATSSTGKLELLKSLGADLAIDYTKENFEDLPDKFDVVYDSVGQGEKAVKAVKEGGSVVVLTGAVTPPGFR
FVVTSNGEMLKKLNPYLESGKVKPVIDPKGPFSFDKVVDAFSYLETGRATGKIVIHPIP
Predicted Coding Sequence 
ATGAAAGCTCTATTATCTTCCACTACTCTTCAACTCAAACCCCTTCATCCACCCTCTTCTTTCTCTTCTCTTCACTCTCCATTTTCTTCT
ATTTCTGTTCTTAGAGTAAAGGGTAGCAAAAAAGCTGAAACTTTTATTCAAAGAAGCAAATTTTCCACTGTTTTGCCACTTAAAGCTCTT
AACCCTGTTGATTTTAAACGACGGCTCGGAAAATTTAAGGCCACTGATTCTCCACTTCCAACTGTGCCAGGTTATGATGTTGCTGGTGTG
GTAGTGAAAGTTGGTAGTCAGGTAAAGGGATTAAAAGAAGGGGATGAAGTATATGGAGATATACATGAGAAAGCATTAGATGGACCAAAG
CAATTTGGATCCTTAGCTGAGTACACTGCTGTTGAAGAGAAACTAGTTGCCTTGAAACCCAAGAATCTTAGTTTTGCGGAGGCTGCTGCT
CTTCCTCTAGCTATTGAGACTGCTTATGAAGGTCTTGAGAAAGCAGGATTTTCTTCTGGCAAATCCGTTCTTGTTTTGGGAGGTGCTGGC
GGTGTTGGATCCCTAGTAATCCAGCTTGCTAAACATGTATTTGGTGCTTCTAAAGTAGCAGCTACCTCTAGCACAGGGAAGTTGGAACTC
CTGAAAAGCTTAGGAGCTGATTTAGCTATTGACTACACTAAGGAGAATTTTGAAGATCTGCCTGACAAGTTTGATGTTGTTTATGATTCA
GTTGGTCAGGGTGAAAAGGCGGTGAAGGCAGTGAAGGAAGGTGGGAGTGTGGTAGTGCTAACAGGGGCAGTAACACCACCAGGTTTTAGA
TTTGTGGTGACATCAAATGGAGAGATGTTGAAGAAACTGAACCCATACTTGGAAAGTGGGAAGGTGAAACCAGTGATAGATCCAAAGGGA
CCATTCTCATTTGATAAGGTTGTGGATGCTTTCTCTTATCTTGAAACTGGAAGAGCCACTGGGAAAATTGTTATTCATCCCATTCCTTGA
Edits in Original Sequence 
ATTTCATCTTCTTTATCATGCACATAAATTGTTTGAGGAAAATACTGAGTGAGAGGTTAAAAAAACAGCTGGAAAGAAAGAAGAACA(5')
ATGAAAGCTCTATTATCTTCCACTACTCTTCAACTCAAACCCCTTCATCCACCCTCTTCTTTCTCTTCTCTTCACTCTCCATTTTCTTC
TATTTCTGTTCTTAGAGTAAAGGGTAGCAAAAAAGCTGAAACTTTTATTCAAAGAAGCAAATTTTCCACTGTTTTGCCACTTAAAGtCTC
TTAACCCTGTTGATTTTAAACGACGGCTCGGAAAATTTAAGGCCACTGATTCTCCACTTCCAACTGTGCCAGGTTATGATGTTGCTGGTG
TGGTAGTGAAAGTTGGTAGTCAGGTAAAGGGATTAAAAGAAGGGGATGAAGTATATGGAGATATACATGAGAAAGCATTAGATGGACCAA
AGCAATTTGGATCCTTAGCTGAGTACACTGCTGTTGAAGAGAAACTAGTTGCCTTGAAACCCAAGAATCTTAGTTTTGCGGAGGCTGCTG
CTCTTCCTCTAGCTATTGAGACTGCTTATGAAGGTCTTGAGAAAGCAGGATTTTCTTCTGGCAAATCCGTTCTTGTTTTGGGAGGTGCTG
GCGGTGTTGGATCCCTAGTAATCCAGCTTGCTAAACATGTATTTGGTGCTTCTAAAGTAGCAGCTACCTCTAGCACAGGGAAGTTGGAAC
TCCTGAAAAGCTTAGGAGCTGATTTAGCTATTGACTACACTAAGGAGAATTTTGAAGATCTGCCTGACAAGTTTGATGTTGTTTATGATT
CAGTTGGTCAGGGTGAAAAGGCGGTGAAGGCAGTGAAGGAAGGTGGGAGTGTGGTAGTGCTAACAGGGGCAGTAACACCACCAGGTTTTA
GATTTGTGGTGACATCAAATGGAGAGATGTTGAAGAAACTGAACCCATACTTGGAAAGTGGGAAGGTGAAACCAGTGATAGATCCAAAGG
GACCATTCTCATTTGATAAGGTTGTGGATGCTTTCTCTTATCTTGAAACTGGAAGAGCCACTGGGAAAATTGTTATTCATCCCATTCCTT
GA(3')AAGTTAGCTCTTATTTTGTACAATTTCTAATACATTTAGGGAAAAGGAGAAGTTTTTGTTCCTCAAAGCCTATTGTGGCATGTG
GTTGATGAAAATAAGATGTATCTATGTTGATCATGTTGGACACAGAAATAATTACTTAGAAGGATTTTTGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan