Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U314204

Score 
1159
Direction 
Forward
Predicted Peptide Sequence 
MASLSRFLKKRSLDYNNVDLMRAASNRLFSTQLPHTNIKSEVSQLIGKTPMVYLKKVTEGCGAYIAVKQEMFQPTSSIKDRPALAMINDA
EKKGLISPEKTTLIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAYDLLESTPNAFMLQQ
FSNPANTQVHFDTTGPEIWEESLGNVDIFVMGIGSGGTVTGVGQYLKSKNPNVKIYGLEPTESNILNGGKPGPHHITGNGVGFKPDILDM
DLMEEVLMVSSEDAVNMARELAVKEGLMVGISSGANTVAALRLAQKPENKGKLIVTVHASFGERYLSSVLYQDLRKEAENMQPISVD
Predicted Coding Sequence 
ATGGCAAGTTTAAGCAGATTCTTGAAGAAAAGATCATTAGATTATAATAATGTTGATTTGATGAGAGCAGCTAGCAACAGATTGTTCTCT
ACACAACTTCCTCATACTAACATCAAGTCTGAAGTTTCTCAATTAATTGGGAAAACACCAATGGTTTATCTTAAAAAAGTGACAGAAGGA
TGTGGAGCCTATATAGCTGTGAAACAGGAGATGTTTCAGCCTACTTCTAGCATCAAAGACAGACCAGCATTGGCAATGATCAATGATGCA
GAAAAAAAAGGCTTAATATCACCTGAAAAGACGACGTTGATTGAGCCAACATCAGGAAATATGGGGATCAGTATGGCATTTATGGCAGCA
ATGAAAGGCTACAAAATGGTTTTGACTATGCCATCGTACACGAGCATGGAGAGGAGAGTGACAATGAGAGCATTTGGAGCCGACTTAATC
CTCACCGATCCAACCAAAGGAATGGGAGGCACTGTTAAGAAGGCTTATGATCTTTTGGAATCGACACCTAATGCTTTCATGCTTCAACAA
TTTTCCAACCCCGCAAACACTCAGGTTCATTTTGACACAACTGGCCCTGAAATATGGGAAGAAAGTCTAGGTAATGTTGATATATTTGTT
ATGGGAATAGGAAGTGGAGGCACTGTTACTGGTGTTGGACAATATCTTAAATCCAAAAATCCTAATGTCAAGATATATGGACTTGAGCCA
ACTGAAAGCAATATACTGAATGGTGGAAAACCAGGTCCTCATCATATAACGGGAAATGGGGTCGGGTTCAAGCCAGATATCCTTGATATG
GATCTAATGGAGGAAGTACTAATGGTTTCTAGCGAAGACGCTGTAAACATGGCTAGGGAGTTGGCAGTGAAGGAAGGACTCATGGTTGGG
ATATCGTCGGGAGCTAATACAGTAGCAGCTCTTAGACTAGCTCAAAAACCAGAAAACAAAGGCAAACTCATAGTGACTGTACATGCAAGT
TTTGGTGAGCGATACTTATCATCTGTGTTGTATCAAGATCTGAGGAAAGAAGCTGAGAATATGCAACCTATTTCAGTCGATTAA
Edits in Original Sequence 
AAAAAAAAAAAGGTCAATTGCATAGAGAGTACCTTTTTTTGTGTAAAATTTAAAGTGCAATAATTTTGAAGAATTCATCA(5')ATGGCA
AGTTTAAGCAGATTCTTGAAGAAAAGATCATTAGATTATAATAATGTTGATTTGATGAGAGCAGCTAGCAACAGATTGTTCTCTACACAA
CTTCCTCATACTAACATCAAGTCTGAAGTTTCTCAATTAATTGGGAAAACACCAATGGTTTATCTTAAAAAAGTGACAGAAGGATGTGGA
GCCTATATAGCTGTGAAACAGGAGATGTTTCAGCCTACTTCTAGCATCAAAGACAGACCAGCATTGGCAATGATCAATGATGCAGAAAAA
AAAGGCTTAATATCACCTGAAAAGACGACGTTGATTGAGCCAACATCAGGAAATATGGGGATCAGTATGGCATTTATGGCAGCAATGAAA
GGCTACAAAATGGTTTTGACTATGCCATCGTACACGAGCATGGAGAGGAGAGTGACAATGAGAGCATTTGGAGCCGACTTAATCCTCACC
GATCCAACCAAAGGAATGGGAGGCACTGTTAAGAAGGCTTATGATCTTTTGGAATCGACACCTAATGCTTTCATGCTTCAACAATTTTCC
AACCCCGCAAACACTCAGGTTCATTTTGACACAACTGGCCCTGAAATATGGGAAGAAAGTCTAGGTAATGTTGATATATTTGTTATGGGA
ATAGGAAGTGGAGGCACTGTTACTGGTGTTGGACAATATCTTAAATCCAAAAATCCTAATGTCAAGATATATGGACTTGAGCCAACTGAA
AGCAATATACTGAATGGTGGAAAACCAGGTCCTCATCATATAACGGGAAATGGGGTCGGGTTCAAGCCAGATATCCTTGATATGGATCTA
ATGGAGGAAGTACTAATGGTTTCTAGCGAAGACGCTGTAAACATGGCTAGGGAGTTGGCAGTGAAGGAAGGACTCATGGTTGGGATATCG
TCGGGAGCTAATACAGTAGCAGCTCTTAGACTAGCTCAAAAACCAGAAAACAAAGGCAAACTCATAGTGACTGTACATGCAAGTTTTGGT
GAGCGATACTTATCATCTGTGTTGTATCAAGATCTGAGGAAAGAAGCTGAGAATATGCAACCTATTTCAGTCGATTAA(3')ATATCGAA
AACTCATCAGCAAGAAAAATGTAAAACTTTTTTTTTTTTTTGTTCATTCTAAATGATGTTTGCTGAATGTCTGCTGTTTGGTTGGTTGCC
TTTTATGAATCTACATCTTAGCATGTAAAATGAGCAAGTGAATTTATTGTTATTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan