ESTScan Details for Unigene SGN-U314223

Score 
1446
Direction 
Forward
Predicted Peptide Sequence 
RSSKISVSNFENFFRYSNYWRKGIRRFCSSAVVHEEPITPPVEVKYNQLLINGQFVDAASGKTFPTFDPRTGEAITTVAEADTEDVNRAV
FAARKAFDEGPWPKMLERSCIMLQFADLLERHSDELAALETWDKGKPYEQAANEEIPMLIRLFRYYAVKKXKKNGVMFPFDSLITTYCIS
IDVLMFAEXTLNAFLSISAYISYSGWADKIHGLTAPADSLHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLKPAEQTPL
SALYVSKLFHEVGLPPGVLNVIPGSGSAGADLASHMDVDKIAFTGSTETGKAVVGAAAKSNLKPVTLELGGKSPFIICEDADVDKAVELA
HSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRIVGDPFKKGVEQGPQIDTEQFEKILKYIKSGTESGATLESGGEKLGSKGFY
VQPTVFSNVQDNMLIARDEIFGPVQSLLKFKDVEEVIRRANSSHYGLAAGVFTQNIDAANTISRALRVGTVWVNCFNIFDAAIPFGGYKM
SGHGREKGVYSLSNYLQVKAIVTPLKNPAWL
Predicted Coding Sequence 
AGGTCCTCTAAGATTTCTGTAAGCAACTTTGAAAATTTCTTTAGGTACTCCAACTACTGGAGAAAGGGTATCAGAAGGTTTTGTAGCAGT
GCCGTGGTGCATGAAGAGCCAATCACTCCACCTGTTGAGGTTAAATATAATCAGCTTCTCATTAATGGACAGTTTGTTGATGCAGCCTCA
GGGAAGACATTTCCTACATTTGACCCTCGAACAGGCGAAGCTATTACTACGGTTGCGGAGGCCGACACTGAAGATGTCAACCGTGCAGTC
TTTGCTGCCCGTAAAGCATTTGATGAAGGACCATGGCCTAAAATGCTTGAAAGGTCATGTATAATGTTGCAGTTTGCTGATTTGCTTGAG
AGGCACAGTGATGAACTTGCAGCACTTGAGACTTGGGATAAGGGAAAGCCTTACGAACAAGCTGCAAATGAAGAAATACCAATGCTCATT
CGTCTTTTCAGATACTATGCTGTTAAGAAAATXAAGAAAAATGGCGTTATGTTTCCTTTTGACAGTTTAATAACCACTTATTGTATATCA
ATTGACGTTCTAATGTTTGCTGAAXTCACCCTAAATGCTTTTCTAAGTATTTCTGCTTACATTTCTTATTCAGGTTGGGCTGATAAAATT
CATGGTCTTACAGCTCCTGCTGACAGTTTGCACCATGTTCAGACCCTGCATGAGCCAATTGGTGTTGCAGGACAGATAATACCCTGGAAT
TTTCCGTTATTAATGTTCGCCTGGAAAGTTGGCCCTGCACTTGCTTGTGGTAACACTGTCGTACTAAAACCAGCAGAACAAACACCACTC
TCTGCCCTGTATGTGTCAAAGTTATTCCATGAGGTTGGACTTCCCCCTGGAGTCTTAAATGTCATTCCTGGATCCGGTAGTGCAGGTGCA
GATCTTGCCAGTCATATGGATGTCGATAAGATTGCTTTTACAGGGTCCACAGAAACTGGTAAAGCTGTCGTAGGTGCAGCTGCAAAGAGC
AACCTAAAACCTGTGACATTGGAGCTCGGAGGAAAATCTCCTTTCATCATTTGTGAAGATGCAGACGTTGATAAAGCTGTTGAGTTGGCT
CATTCTGCTGTTTTCTTTAACCAGGGACAATGCTGCTGTGCTGGATCTCGGACATTCGTACATGAAAGAGTATATGATGAATTTGTGGAG
AAAGCCAAAGCTCGTGCTTTAAAACGCATTGTTGGAGACCCTTTCAAGAAGGGAGTTGAACAAGGTCCGCAGATTGATACAGAGCAATTT
GAGAAGATCCTGAAGTACATAAAATCTGGTACTGAAAGCGGGGCTACTCTCGAGTCTGGAGGGGAAAAATTGGGTTCCAAGGGCTTCTAT
GTCCAACCTACTGTCTTCTCAAATGTCCAGGATAACATGCTGATTGCCAGAGATGAGATATTTGGACCAGTGCAGTCCCTCTTGAAATTC
AAGGATGTTGAAGAGGTCATCCGAAGGGCAAACTCGTCACATTATGGGTTGGCAGCGGGTGTTTTTACCCAGAATATAGATGCAGCCAAC
ACAATATCTCGAGCCCTTAGAGTAGGGACAGTGTGGGTTAACTGCTTTAACATCTTTGATGCTGCCATTCCGTTTGGTGGTTATAAGATG
AGTGGACATGGAAGAGAGAAGGGAGTCTACAGCCTAAGTAACTACTTGCAAGTCAAAGCTATTGTTACCCCTCTGAAGAATCCAGCATGG
CTGTAG
Edits in Original Sequence 
GAACAATTTTGAATGCTCTCTCTTTATGTAAACATTATGCTTTGTATGAAATAA(5')AGGTCCTCTAAGATTTCTGTAAGCAACTTTGA
AAATTTCTTTAGGTACTCCAACTACTGGAGAAAGGGTATCAGAAGGTTTTGTAGCAGTGCCGTGGTGCATGAAGAGCCAATCACTCCACC
TGTTGAGGTTAAATATAATCAGCTTCTCATTAATGGACAGTTTGTTGATGCAGCCTCAGGGAAGACATTTCCTACATTTGACCCTCGAAC
AGGCGAAGCTATTACTACGGTTGCGGAGGCCGACACTGAAGATGTCAACCGTGCAGTCTTTGCTGCCCGTAAAGCATTTGATGAAGGACC
ATGGCCTAAAATGaCTTGAAAGGTCATGTATAATGTTGCAGTTTGCTGATTTGCTTGAGAGGCACAGTGATGAACTTGCAGCACTTGAGA
CTTGGGATAAGGGAAAGCCTTACGAACAAGCTGCAAATGAAGAAATACCAATGCTCATTCGTCTTTTCAGATACTATGCTgGTTAAGAAA
ATXAAGAAAAATGGCGTTATGTTTCCTTTTGACAGTTTAATAACCACTTATTGTATATCAATTGACGTTCTAATGTTTGCTGAAXTCACC
CTAAATGCTTTTCTAAGTATTTCTGCTTACATTTCTTATTCAGGTTGGGCTGATAAAATTCATGGTCTTACAGCTCCTGCTGACAGTTTG
CACCATGTTCAGACCCTGCATGAGCCAATTGGTGTTGCAGGACAGATAATACCCTGGAATTTTCCGTTATTAATGTTCGCCTGGAAAGTT
GGCCCTGCACTTGCTTGTGGTAACACTGTCGTACTAAAACCAGCAGAACAAACACCACTCTCTGCCCTGTATGTGTCAAAGTTATTCCAT
GAGGTTGGACTTCCCCCTGGAGTCTTAAATGTCATTCCTGGATCCGGTAGTGCAGGTGCAGATCTTGCCAGTCATATGGATGTCGATAAG
ATTGCTTTTACAGGGTCCACAGAAACTGGTAAAGCTGTCGTAGGTGCAGCTGCAAAGAGCAACCTAAAACCTGTGACATTGGAGCTCGGA
GGAAAATCTCCTTTCATCATTTGTGAAGATGCAGACGTTGATAAAGCTGTTGAGTTGGCTCATTCTGCTGTTTTCTTTAACCAGGGACAA
TGCTGCTGTGCTGGATCTCGGACATTCGTACATGAAAGAGTATATGATGAATTTGTGGAGAAAGCCAAAGCTCGTGCTTTAAAACGCATT
GTTGGAGACCCTTTCAAGAAGGGAGTTGAACAAGGTCCGCAGATTGATACAGAGCAATTTGAGAAGATCCTGAAGTACATAAAATCTGGT
ACTGAAAGCGGGGCTACTCTCGAGTCTGGAGGGGAAAAATTGGGTTCCAAGGGCTTCTATGTCCAACCTACTGTCTTCTCAAATGTCCAG
GATAACATGCTGATTGCCAGAGATGAGATATTTGGACCAGTGCAGTCCCTCTTGAAATTCAAGGATGTTGAAGAGGTCATCCGAAGGGCA
AACTCGTCACATTATGGGTTGGCAGCGGGTGTTTTTACCCAGAATATAGATGCAGCCAACACAATATCTCGAGCCCTTAGAGTAGGGACA
GTGTGGGTTAACTGCTTTAACATCTTTGATGCTGCCATTCCGTTTGGTGGTTATAAGATGAGTGGACATGGAAGAGAGAAGGGAGTCTAC
AGCCTAAGTAACTACTTGCAAGTCAAAGCTATTGTTACCCCTCTGAAGAATCCAGCATGGCTGTAG(3')TTTTCCCCCCTGCTTTCTGG
TACTCCTGAGATGTCGTGCAACACGGCAATCTTGTCTTTTAGAGGTCACTTGTATACAGTGTAGATAAGACCAAAACGCTGTATTGTGTG
TGTGTTATTGTTTGTTACTAACTTCTTATGATTTGATAACAATATGCAAACTTGTTTGTGTGAGACCTTTCTTGATTTCTGTAGCTCTGA
TGCAAAATAGGATCTTGTGTTTGAGTTTTGTGGGAATGTAATGAATTATATATAGATGTAATGTTATAATTCTATATTACTACGGTATAT
ATCTTGTTCAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan