ESTScan Details for Unigene SGN-U314258

Score 
400
Direction 
Forward
Predicted Peptide Sequence 
MILLIHTSIEXRVVDLRPRSSFFEFKLLNPPNNIHLQQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLLSEIEYLLKN
GWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY
Predicted Coding Sequence 
ATGATCCTCCTCATTCATACTTCCATTGAAGXTAGAGTTGTTGATCTTCGTCCTCGTTCXTCCTTTTTTGAATTCAAATTGTTGAATCCA
CCGAATAATATCCATCTTCAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCA
ATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAAT
GGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATAC
TGGACCATGTGGAAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAG
GCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
AAAAACATAATATTAATGTATTGATTTCTATATGGTGAGGAGAGCATTGATTATCTGAACTTTCTCCGAGTTCTACGCGTACTATACATA
TATCAGTTTCTAGAGGTGTCACAACTAAAAGAGATGATTGTAATTTTAACTTTGCCAAGTTTTATGATTTTTAACTTCAGTATTAACAAG
AGCAGCAATGTTGAAAATGTCATCACTGTGAGAGAGAGGTTTTAAACCCAAGAAATCTTTGGTTAATAT
(5')ATGATCCTCCTCATTCA
TACTTCCATTGAAGXTAGAGTTGTTGATCTTCGTCCTCGTTCXTCCTTTTTTGAATTCAAATTGTTGAATCCACCGAATAATATCgCATC
TTCAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGT
ACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCT
TGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGT
TGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCA
TCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA(3')AATGCCAATTTTTAATTA
TGTAATGTATAACTGACCCTATGTATTTAGGGGAAGCTTGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACT
TTGTTGTGTTCCCTTCATCTTTTGAATTAATGGCATTTGTTTTAATACTAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan