Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U314276

Score 
593
Direction 
Forward
Predicted Peptide Sequence 
MAPKQPNTGISVGLNKGHVVTKKELAPRPSDRKGKTSKRIHFVRSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKR
EEMSSVLRKMRATGGGEKKKXRPVSITTDV
Predicted Coding Sequence 
ATGGCTCCAAAGCAGCCGAATACAGGGATATCTGTTGGTCTAAACAAAGGCCATGTTGTGACCAAGAAGGAATTAGCTCCACGCCCTTCT
GACAGAAAAGGGAAAACAAGCAAAAGAATACACTTTGTGAGGAGTCTTATCAGAGAAGTTGCTGGATTTGCTCCATATGAGAAGAGGATC
ACTGAGCTTCTCAAAGTTGGAAAGGACAAGCGTGCCTTGAAGGTAGCCAAGAGGAAGTTGGGTACTCACAAGAGGGCAAAGAGGAAGAGA
GAAGAGATGTCTAGTGTTCTCCGCAAGATGAGGGCTACTGGAGGTGGTGAAAAGAAGAAGXTGAGGCCTGTATCCATCACTACTGATGTT
TGA
Edits in Original Sequence 
GAACAACGAGTATCTTGTTCAAAGGTCTATATAATTCACTAATCTATAAAGTTGGACAACATATACAAAGATCAACAGTTCTTTGATTTG
GTTTAAGCATTTTCAGAGAAATAGTAAAAGGGGGTTACGTCGGAGCAGATCCAACACATTGAAGAGGTG
(5')ATGGCTCCAAAGCAGCC
GAATACAGGGATATCTGTTGGTCTAAACAAAGGCCATGTTGTGACCAAGAAGGAATTAGCTCCACGCCCTTCTGACAGAAAAGGGAAAAC
AAGCAAAAGAATACACTTTGTGAGGAGTCTTATCAGAGAAGTTGCTGGATTTGCTCCATATGAGAAGAGGATCACTGAGCTTCTCAAAGT
TGGAAAGGACAAGCGTGCCTTGAAGGTAGCCAAGAGGAAGTTGGGTACTCACAAGAGGGCAAAGAGGAAGAGAGAAGAGATGTCTAGTGT
TCTCCGCAAGATGAGGGCTACTGGAGGTGGTGAAAAGAAGAAGXTGAGGCCTGTATCCATCACTACTGATGTTTGA(3')AGGACCCAGT
TAGTTAATTCACCAGCTTTTACGTGTGCAATGTATTTTTGTTTTCAAGAAAGAGGACTTGTGATCGAAAAGTTCCCTGTTTATGTTCGAT
GAATATTTTGGAATTAGTGATTCTTTAGACATTTTTGCAAAAAAAAAAAAAAAAAAAAAATGCTTTTCTGGTATTATTTGTGTTGACTAT
CTGCTTGATCTTTGAAATGACTTGGGCCAAGAAATTTGCCCATGTTGCCCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan