ESTScan Details for Unigene SGN-U314303

Score 
1309
Direction 
Forward
Predicted Peptide Sequence 
MDAEAIVKELRGTYGSGKTKSYEWRVSQLKSLLKIAENHEKEITDALYSDLSKSEFEAFIYEVSIMKTTCKLALKELKRWMKPEKVKTSI
TSFPSSAEIVPEPLGVVLVISAWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSVLAKLLGQYMDVSAIRVVEGAVPETTALLEQKW
DKIFYTGNGKVGRIVLAAAAKHLTPVVLELGGKSPVVVDSNIDYKIAVRRIIAGKWGCNNGQACISPDYIITTKESVPKLLDAMKQELEK
FYGKDPLKSGDLSRIVNANHFQRLSKLLDDNKVVDKVVHGGQRDENNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNKVEDSIQFIK
AREKPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSFDTFSHKKAVLRRSFAGDVPARYPPYTA
GKARFLKALLNGDXNRAHSCFDWVVKVPFNI
Predicted Coding Sequence 
ATGGATGCAGAGGCGATTGTGAAGGAATTGAGAGGGACGTACGGGAGTGGGAAGACGAAGAGTTACGAGTGGAGAGTGTCGCAGTTGAAA
AGTTTATTGAAGATTGCTGAGAATCATGAGAAGGAGATTACCGATGCTCTTTATTCTGACCTCTCTAAGTCTGAATTTGAAGCCTTTATT
TATGAGGTTTCTATAATGAAAACAACATGTAAACTTGCATTGAAGGAACTAAAACGGTGGATGAAGCCGGAAAAAGTCAAAACTTCAATA
ACCTCGTTTCCTTCATCAGCTGAAATAGTTCCAGAACCTCTCGGTGTTGTATTGGTCATATCAGCATGGAACTATCCGTTCTTGTTGTCC
CTTGATCCAGTGATTGGAGCTATTGCTGCTGGTAATGCAGTAGTTCTGAAACCATCAGAAATAGCCCCAGCTACATCTTCAGTGCTTGCA
AAGCTATTAGGGCAGTATATGGATGTGTCTGCTATCAGAGTTGTAGAAGGGGCAGTACCTGAGACAACTGCATTACTAGAGCAAAAATGG
GACAAGATATTTTATACAGGAAATGGAAAAGTTGGACGGATTGTGCTGGCTGCTGCTGCAAAGCACTTGACACCTGTGGTTTTGGAGCTA
GGTGGTAAATCTCCAGTTGTGGTGGATTCAAACATCGATTACAAGATTGCAGTAAGGCGTATTATTGCTGGCAAGTGGGGCTGCAACAAT
GGACAAGCGTGCATCTCTCCTGATTATATAATTACTACCAAAGAAAGTGTGCCAAAATTGCTAGATGCTATGAAACAGGAATTGGAGAAA
TTCTATGGAAAGGATCCACTAAAATCAGGAGATCTATCTCGCATTGTGAATGCTAACCACTTTCAACGACTATCAAAGTTACTGGATGAT
AATAAGGTTGTCGATAAGGTAGTTCATGGAGGTCAGAGAGATGAAAATAATTTAAAGATCTCTCCTACAATTCTTCTGGATGTCCCAGAA
GATTCTTTAATCATGAAGGAGGAAATATTTGGTCCTCTACTTCCTATTATCACGGTCAATAAAGTGGAGGATTCTATACAATTCATTAAA
GCCAGAGAAAAGCCACTTGCAGCATATCTGTTCACAAGCAACAAGAAACTGGAGGAGGAGTTTGTCATGAATATATCAGCAGGGGGTCTG
CTTATCAATGACACCACTTTACAAGTTGCGCTTTCTACTCTTCCATTTGGAGGAGTAGGGGAAAGTGGAATGGGTTCATGTCATGGCAAA
TTTTCGTTTGATACTTTCAGCCATAAGAAGGCAGTTCTACGTCGCAGTTTTGCTGGGGATGTACCTGCAAGATATCCACCTTATACAGCT
GGCAAGGCGCGATTTCTCAAAGCCCTGTTAAATGGTGATXATAATCGGGCTCATTCGTGCTTTGATTGGGTGGTAAAAGTTCCATTCAAT
ATTTGA
Edits in Original Sequence 
GAAGAGGGAGTACAATATTCAAGTATTTAAAAATACTCATTTAATAACTAAAATAATAATACGATATATCGCCGGCGAAGCACAGGCGAC
GAGCACAAAGTCGTCGACCTAATCACACGATATATATATATTATATAGATATAGAATAAAGGTTGCGAGAA
(5')ATGGATGCAGAGGCG
ATTGTGAAGGAATTGAGAGGGACGTACGGGAGTGGGAAGACGAAGAGTTACGAGTGGAGAGTGTCGCAGTTGAAAAGTTTATTGAAGATT
GCTGAGAATCATGAGAAGGAGATTACCGATGCTCTTTATTCTGACCTCTCTAAGTCTGAATTTGAAGCCTTTATTTATGAGGTTTCTATA
ATGAAAACAACATGTAAACTTGCATTGAAGGAACTAAAACGGTGGATGAAGCCGGAAAAAGTCAAAACTTCAATAACCTCGTTTCCTTCA
TCAGCTGAAATAGTTCCAGAACCTCTCGGTGTTGTATTGGTCATATCAGCATGGAACTATCCGTTCTTGTTGTCCCTTGATCCAGTGATT
GGAGCTATTGCTGCTGGTAATGCAGTAGTTCTGAAACCATCAGAAATAGCCCCAGCTACATCTTCAGTGCTTGCAAAGCTATTAGGGCAG
TATATGGATGTGTCTGCTATCAGAGTTGTAGAAGGGGCAGTACCTGAGACAACTGCATTACTAGAGCAAAAATGGGACAAGATATTTTAT
ACAGGAAATGGAAAAGTTGGACGGATTGTGCTGGCTGCTGCTGCAAAGCACTTGACACCTGTGGTTTTGGAGCTAGGTGGTAAATCTCCA
GTTGTGGTGGATTCAAACATCGATTACAAGATTGCAGTAAGGCGTATTATTGCTGGCAAGTGGGGCTGCAACAATGGACAAGCGTGCATC
TCTCCTGATTATATAATTACTACCAAAGAAAGTGTGCCAAAATTGCTAGATGCTATGAAACAGGAATTGGAGAAATTCTATGGAAAGGAT
CCACTAAAATCAGGAGATCTATCTCGCATTGTGAATGCTAACCACTTTCAACGACTATCAAAGTTACTGGATGATAATAAGGTTGTCGAT
AAGGTAGTTCATGGAGGTCAGAGAGATGAAAATAATTTAAAGATCTCTCCTACAATTCTTCTGGATGTCCCAGAAGATTCTTTAATCATG
AAGGAGGAAATATTTGGTCCTCTACTTCCTATTATCACGGTCAATAAAGTGGAGGATTCTATACAATTCATTAAAGCCAGAGAAAAGCCA
CTTGCAGCATATCTGTTCACAAGCAACAAGAAACTGGAGGAGGAGTTTGTCATGAATATATCAGCAGGGGGTCTGCTTATCAATGACACC
ACTTTACAAGTTGCGCTTTCTACTCTTCCATTTGGAGGAGTAGGGGAAAGTGGAATGGGTTCATGTCATGGCAAATTTTCGTTTGATACT
TTCAGCCATAAGAAGGCAGTTCTACGTCGCAGTTTTGCTGGGGATGTACCTGCAAGATATCCACCTTATACAGCTGGCAAGGCGCGATTT
CTCAAAGCCCTGTTAAATGGTGATXATAATCGGGCTCATTCGTGCTTTGATTGGGTGGTAAAAGTTCCATTCAATATTTGA(3')ATCTG
GGATTTCTGGTGTGAGCCCACTACTACACTTGTAAGTAGTTGATCATCCTCTACCCTTGAGGCAATAAATTACCTTCCACATTTTCAAGT
CACTCCTTTTATAAATTTCATGTATCGCTATGTTACTATATACTATTTTGTTTTTTCTTGTATAAATGTTTACATTATCTAATTGTTATT
AATAATAGAATTTCTACTTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan