ESTScan Details for Unigene SGN-U314455

Score 
1048
Direction 
Forward
Predicted Peptide Sequence 
AELGYLPRSPSSEGSSXPPSTTAISAVSELYXKIESAKRDFGIQITFTSQVALNQIEXLGIRKXMAHRLLRDAEADGWERSDFPIICESC
LGDSPYVRMTKADYDKDARSARDPSQCSGGGLVGMRDTKSLRSVRPAAIEECLSSLPVDLEYGLPVQVRDTALSINSNDAIPKSDVNREY
FAEEHDRRARAGIDYESSYGKVRANDTIMKLQRTTPYYKRNRAHVCSFYIRGQCTRGLECPYRHEMPETGELSQQNIKDRYYGVNDPVAL
KLLNKAGEMPSLEPPDDESIRTLYVGGVDARITEQDLRDHFYAHGEIESIKMVVQRGCAFVTYTTREGAVKAAEELANKLVIKGLRLKLL
WGRPQVPKPESEVSDEARQQAALTHSGLLPRAVVSQQQNQPLQPPGTQDQPPSMPYFNIPPMPQQDRPYYPSMDPQRMGAVIASQEGASS
STAGSGPGENKIGSDHQQGHHYAYPPGGPPPPGQFYPPYYRPAYGYMPPPPPPYHQYPPPPYQATAHPPPSVQLAAHQQNPRPAAAATXA
AALIWAVLSDICYGKKNRPSIACHFESSAHSVFPVENLGVRFQVLICLTIISFKPFTIYAELHSALISMQFYEFYSCARHIYMRIVI
Predicted Coding Sequence 
XGGGCTGAGCTGGGCTATTTGCCTCGCTCTCCTTCGTCGGAAGGTTCTTCTXCTCCGCCGTCGACAACAGCCATCTCCGCCGTCTCTGAG
CTCTATXATAAAATTGAGTCTGCTAAGCGAGATTTTGGCATTCAAATAACTTTCACTAGCCAAGTTGCTCTTAATCAGATTGAAGXTTTA
GGAATTAGAAAAXCGATGGCGCATAGGTTGCTGAGAGATGCTGAAGCTGATGGATGGGAACGATCTGATTTCCCTATTATATGCGAGTCG
TGTCTCGGTGACAGTCCCTATGTGCGAATGACAAAAGCAGATTATGACAAGGATGCAAGATCTGCACGCGACCCTTCACAGTGTTCAGGT
GGAGGCCTGGTCGGGATGCGAGATACAAAAAGTCTGAGATCTGTCAGACCTGCAGCAATTGAAGAATGTTTGTCAAGTTTGCCTGTTGAT
CTTGAATATGGTTTGCCTGTTCAGGTCCGAGACACTGCTCTCAGTATCAACTCAAATGATGCCATCCCAAAGAGTGACGTAAATAGAGAA
TATTTTGCAGAGGAGCATGACCGAAGGGCAAGGGCTGGTATTGATTATGAATCTTCATATGGAAAAGTCCGTGCAAATGATACTATCATG
AAGCTTCAAAGAACAACTCCATACTACAAGAGAAATCGGGCACATGTTTGCAGTTTCTACATACGTGGTCAATGTACAAGAGGTTTGGAG
TGTCCTTACCGGCATGAGATGCCTGAAACAGGGGAATTGTCACAGCAAAATATCAAAGACCGTTACTATGGAGTCAATGATCCAGTGGCT
TTAAAGCTACTTAATAAAGCAGGTGAAATGCCTTCATTGGAGCCCCCTGATGACGAGAGCATTAGAACCCTCTATGTGGGTGGTGTTGAT
GCAAGAATCACTGAGCAGGACCTTAGGGACCATTTTTATGCACATGGTGAAATTGAGTCCATTAAAATGGTGGTCCAGCGTGGTTGTGCT
TTTGTAACTTACACGACTAGAGAAGGTGCGGTGAAGGCAGCTGAGGAACTTGCAAACAAGCTGGTGATAAAGGGCCTGAGACTGAAGCTA
CTCTGGGGGAGACCTCAAGTTCCCAAGCCAGAGTCCGAGGTCTCTGATGAAGCAAGACAGCAGGCTGCTCTAACTCACAGTGGTTTGTTG
CCTAGAGCAGTCGTATCACAGCAGCAGAATCAGCCTCTTCAGCCACCAGGCACTCAGGACCAACCTCCATCCATGCCTTACTTCAACATA
CCCCCGATGCCTCAGCAAGACAGACCATATTATCCATCAATGGATCCACAAAGGATGGGTGCCGTAATTGCATCCCAGGAAGGGGCATCT
AGTTCAACTGCAGGATCTGGTCCTGGTGAAAATAAAATCGGTTCTGATCATCAACAAGGACACCATTATGCATATCCACCTGGAGGGCCA
CCACCTCCAGGTCAATTTTACCCACCTTATTATCGTCCAGCTTATGGATATATGCCACCACCTCCTCCACCTTATCATCAATATCCTCCT
CCACCTTATCAAGCTACTGCACACCCACCACCTAGTGTTCAGCTAGCCGCACATCAGCAGAACCCTCGGCCAGCTGCAGCAGCAACCXAC
GCAGCAGCCTTAATCTGGGCAGTTTTGTCAGACATCTGCTATGGGAAGAAGAATCGACCTTCAATCGCGTGCCATTTTGAATCAAGTGCC
CATTCTGTTTTCCCAGTGGAAAATCTTGGTGTTAGGTTTCAAGTTTTGATTTGCTTGACTATCATCTCATTTAAACCTTTCACCATTTAT
GCXGAATTGCATTCTGCCCTCATCTCCATGCAGTTTTATGAATTTTACAGTTGTGCTAGGCATATATACATGCGCATTGTGATCTAA
Edits in Original Sequence 
(5')XGGGCTGAGCTGGGCTATTTGCCTCGCTCTCCTTCGTCGGAAGGTTCTTCTXCTCCGCCGTCGACAACAGCCATCTCCGCCGTCTC
TGAGCTCTATXATAAAATTGAGTCTGCTAAGCGAGATTTTGGCATTCAAATAACTTTCACTAGCCtAAGTTGCTCTTAATCAGATTGAAG
XTTTAGGAATTAGAAAAXCGATGGCGCATAGGTTGCTGAGAGATGCTGAAGCTGATGGATGGGAACGATCTGATTTCCCTATTATATGCG
AGTCGTGTCTCGGTGACAGTCCCTATGTGCGAATGACAAAAGCAGATTATGACAAGGAgTGCAAGATCTGCACGCGACCCTTCACAGTGT
TCAGGTGGAGGCCTGGTCGGGATGCGAGATACAAAAAGTCTGAGATCTGTCAGACCTGCAGCaAATTGAAGAATGTTTGTCAAGTTTGCC
TGTTaGATCTTGAATATGGTTTGCCTGTTCAGGTCCGAGACACTGCTCTCAGTATCAACTCAAATGATGCCATCCCAAAGAGTGACGTAA
ATAGAGAATATTTTGCAGAGGAGCATGACCGAAGGGCAAGGGCTGGTATTGATTATGAATCTTCATATGGAAAAGTCCGTGCAAATGATA
CTATCATGAAGCTTCAAAGAACAACTCCATACTACAAGAGAAATCGGGCACATGTTTGCAGTTTCTACATACGTGGTCAATGTACAAGAG
GTTTGGAGTGTCCTTACCGGCATGAGATGCCTGAAACAGGGGAATTGTCACAGCAAAATATCAAAGACCGTTACTATGGAGTCAATGATC
CAGTGGCTTTAAAGCTACTTAATAAAGCAGGTGAAATGCCTTCATTGGAGCCCCCTGATGACGAGAGCATTAGAACCCTCTATGTGGGTG
GTGTTGATGCAAGAATCACTGAGCAGGACCTTAGGGACCATTTTTATGCACATGGTGAAATTGAGTCCATTAAAATGGTGGTCCAGCGTG
GTTGTGCTTTTGTAACTTACACGACTAGAGAAGGTGCGGTGAAGGCAGCTGAGGAACTTGCAAACAAGCTGGTGATAAAGGGCCTGAGAC
TGAAGCTACTCTGGGGGAGACCTCAAGTTCCCAAGCCAGAGTCCGAGGTCTCTGATGAAGCAAGACAGCAGGCTGCTCTAACTCACAGTG
GTTTGTTGCCTAGAGCAGTCGTATCACAGCAGCAGAATCAGCCTCTTCAGCCACCAGGCACTCAGGACCAACCTCCATCCATGCCTTACT
TCAACATACCCCCGATGCCTCAGCAAGACAGACCATATTATCCATCAATGGATCCACAAAGGATGGGTGCCGTAATTGCATCCCAGGAAG
GGGCATCTAGTTCAACTGCAGGATCTGGTCCTGGTGAAAATAAAATCGGTTCTGATCATCAACAAGGACACCATTATGCATATCCACCTG
GAGGGCCACCACCTCCAGGTCAATTTTACCCACCTTATTATCGTCCAGCTTATGGATATATGCCACCACCTCCTCCACCTTATCATCAAT
ATCCTCCTCCACCTTATCAAGCTACTGCACACCCACCACCTAGTGTTCAGCTAGCCGCACATCAGCAGAACCCTCGGCCAGCTGCAGCAG
CAACCXACGCAGCAGCCTTAATCTGGGCAGTTTTGTCAGACATCTGCTATGGGAAGAAGAATCGACCTTCAATCGCGTaGCCATTTTGAA
TCAAGTGCCCATTCTGTTTTCCCAGTGGAAAATCTTcGGTGTTAGGTTTCAAGTTTTGATTTGCTTGACTATCATCTCATTTAAACCTTT
CACCATTTATGCXGAATTGCATTCTGCCCTCATCTCCATGCAGTTTTATGAATTTTACAGTTGTGCTAGGCATATATACATGCGCATTGT
GATCTAA(3')TAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan