ESTScan Details for Unigene SGN-U314505

Score 
605
Direction 
Forward
Predicted Peptide Sequence 
SAELRNYSNXFTVQKKMESPRVEESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPPKDRAKKCETHFVFPVIDLQGIDEDPIKHK
EIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPS
LQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFVTILLQDDMGGLQ
VLHQNHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHRAISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRANHSERPH
Predicted Coding Sequence 
XXATCGGCCGAATTGAGAAATTATTCTAATXCATTCACAGTGCAAAAGAAGATGGAAAGCCCTAGAGTTGAGGAGAGTTATGACAAAATG
AGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGATTCTGGAATTACTAAAGTACCTCAAATATTCGTTCTA
CCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGATAGACCTTCAAGGTATCGATGAGGATCCGATTAAGCAT
AAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCAAGTGGTTAATCATGGGATTCCAACATCCGTCTTGGAC
AGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAAACAGTATTACACTCGAGATACTGCGAAAAAAGTGGTT
TATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGACACGATTTTCTGTTACATGGCTCCGAATCCTCCC
AGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTCACTTTACTTGAATTA
TTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTCTTGCAACTACTACCCACCA
TGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACAAGATGATATGGGAGGGCTC
CAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTGGTGAATATTGGAGATTTTCTGCAGCTCTTGTCA
AATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAGTCCA
TATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAGACCA
CACTAG
Edits in Original Sequence 
(5')XXATCGGCCGAATTGAGAAATTATTCTAATXCATTCACAGTGCAAAAGAAGATGGAAAGCCCTAGAGTTGAGGAGAGTTATGACAA
AATGAGTGAATTAAAAGCGTTTGATGATACTAAGGCCGGTGTTAAAGGACTTGTTGATTCTGGAATTACTAAAGTACCTCAAATATTCGT
TCTACCGCCAAAAGACAGGGCTAAAAAATGTGAAACACATTTCGTTTTTCCAGTGATAGACCTTCAAGGTATCGATGAGGATCCGATTAA
GCATAAGGAGATAGTGGACAAAGTTCGAGATGCATCGGAGAAATGGGGTTTTTTCCAAGTGGTTAATCATGGGATTCCAACATCCGTCTT
GGACAGAACGTTGCAAGGAACACGACAGTTCTTTGAGCAAGATAACGAGGTTAAGAAACAGTATTACACTCGAGATACTGCGAAAAAAGT
GGTTTATACTAGCAATCTTGATTTGTATAAATCTTCTGTTCCAGCTGCAAGTTGGAGAGACACGATTTTCTGTTACATGGCTCCGAATCC
TCCCAGTCTACAAGAATTTCCAACTCCATGCGGGGAGTCATTAATAGACTTCTCCAAGGATGTGAAGAAACTGGGATTCACTTTACTTGA
ATTATTGTCTGAAGGTCTCGGTCTCGATCGTAGTTATCTCAAAGATTATATGGATTGTTTTCATCTTTTCTGTTCTTGCAACTACTACCC
ACCATGTCCTCAGCCAGAACTCACCATGGGCACCATTCAACATACCGATATTGGTTTTGTAACGATCCTTCTACAAGATGATATGGGAGG
GCTCCAAGTTCTTCACCAGAATCATTGGGTTGATGTTCCTCCTACACCCGGTTCTCTAGTGGTGAATATTGGAGATTTTCTGCAGCTCTT
GTCAAATGACAAGTACTTAAGTGTCGAGCACAGAGCAATCTCAAACAATGTTGGATCAAGAATGTCAATCACGTGCTTCTTCGGTGAAAG
TCCATATCAATCTTCCAAGCTTTATGGACCGATAACTGAATTGTTATCAGAAGATAATCCTCCAAAATATCGCGCXAACCACAGTGAAAG
ACCACACTAG(3')TTACCTCCATAACAGAGGCCTAGATGGAACTTCTGCATTGTCCCGTTACAAGATCTAAGAATAAGAATAATAATGT
TATCTATTATTACTATTTATACTTCTGCAGATTGTACCTTTGAATTTGAAGCAAATGTTTGAGTTAAATACTTTCACGTTTCTAAGCAAT
GTAATATAATTTATAAAGTATGTGCTTGCTATAAAAAAAAAAAAGTTTAAAACATTAAATAATATTACATAAATATAAACACCATAATAT
AAGGATGTTTAGCATTGTGGGAAAAAAAAAAAAATTGCTGGTGCACACTAAGAAAACCTCGCAGAAAAGTCATTCAATTATTTGACTTAC
GAAATCACTCTTCACTATTGTCATTACAGGTTCGACAGCTACGGTAAACAGGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan