Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U314555

Score 
105
Direction 
Forward
Predicted Peptide Sequence 
QSPKRKKRKKKSSSSSDHKPPSRCPKANDNDVYSPGKSVPIWEILKEQYSIDRSKLCGNSSANDKVQAAGKVDGVAARKGVRSVTEGAEM
KKPWCQLIAEFPWIPFGGKHIMNFFILKIQTQTRDLWLKQKQFLHCNAGYHLFLLFNFFGFNVNTLQKFCLISNRXVNTLQKFCLISNXN
VNTPQNSTVEIFEQRFMTGAGKNLPEHAMICMINREESVMSELCLDAPAVDDPDKLFANTLFEVVFNESRNLPFILFVKDADKVMAGNAE
LYSTFKTRLEKLLNNVIIIG
Predicted Coding Sequence 
XCTCAATCACCCAAAAGAAAAAAAAGGAAAAAGAAGTCATCATCATCGTCCGATCATAAACCTCCTTCGCGATGTCCAAAGGCAAATGAT
AACGATGTGTATTCACCTGGAAAATCGGTACCGATCTGGGAGATATTGAAGGAGCAATATTCGATAGATCGATCCAAACTCTGCGGCAAC
AGCTCGGCTAATGATAAAGTTCAGGCTGCCGGAAAAGTTGACGGCGTTGCTGCCAGAAAAGGTGTCAGATCTGTCACAGAAGGTGCTGAA
ATGAAGAAGCCTTGGTGTCAACTAATAGCAGAGTTTCCTTGGATCCCATTTGGCGGAAAGCATATCATGAATTTTTTCATACTCAAGATT
CAAACACAAACTCGAGATCTCTGGTTAAAACAGAAACAATTCCTCCACTGCAATGCTGGTTATCATCTATTTTTGTTGTTCAATTTTTTT
GGATTTAATGTGAATACACTGCAGAAATTTTGTTTGATATCTAATAGAXATGTGAATACACTGCAGAAATTTTGTTTGATATCTAATXAT
AATGTGAACACACCGCAGAATTCAACAGTGGAGATTTTTGAGCAACGTTTTATGACTGGTGCGGGCAAAAACCTTCCTGAACATGCAATG
ATTTGCATGATAAATCGTGAAGAGTCAGTCATGAGCGAGCTGTGCTTAGACGCCCCTGCCGTGGATGATCCGGACAAGTTATTCGCTAAT
ACATTGTTTGAGGTTGTATTCAATGAGAGCCGGAATTTGCCATTCATTTTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGAAACGCA
GAATTATATTCAACATTTAAAACTCGGCTTGAGAAACTTCTTAATAATGTAATTATTATTGGT
Edits in Original Sequence 
(5')XCTCAATCACCCAAAAGAAAAAAAAGGAAAAAGAAGTCATCATCATCGTCCGATCATAAACCTCCTTCGCGATGTCCAAAGGCAAA
TGATAACGATGTGTATTCACCTGGAAAATCGGTACCGATCTGGGAGATATTGAAGGAGCAATATTCGATAGATCGATCCAAACTCTGCGG
CAACAGCTCGGCTAATGATAAAGTTCAGGCTGCCGGAAAAGTTGACGGCGTTGCTGCCAGAAAAGGTGTCAGATCTGTCACAGAAGGTGC
TGAAATGAAGAAGCCTTGGTGTCAACTAATAGCAGAGTTTCCTTaGGATCCCATTTGGCGGAAAGCATATCATGAATTTTTTCATACTCA
AGATTCAAACACAAACTCGAGATCTCTGGTTAAAACAGAAACAATTCCgTCCACTGCAATGCTGGTTATCATCTATTTTTGTTGTTCAAT
TTTTTTGGATTTAATGTGAATACACTGCAGAAATTTTGTTTGATATCTAATAGAXATGTGAATACACTGCAGAAATTTTGTTTGATATCT
AATXATAATGTGAACACACCGCAGAATTCAACAGTGGAGATTTTTGAGCAACGTTTTATGACTGGTGCGGGCAAAAACCTTCCTGAACAT
GCAATGATTTGCATGATAAATCGTGAAGAGTCAGTCATGAGCGAGCTGTGCTTAGACGCCCCTGCCGTGGATGATCCGGACAAGTTATTC
GCTAATACATTGTTTGAGGTTGTATTCAATGAGAGCCGGAATTTGCCATTCATTTTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGA
AACGCAGAATTATATTCAACATTTAAAACTCGGCTTGAGAAACTTCTTAATAATGTAATTATTATTGGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan