ESTScan Details for Unigene SGN-U314556

Score 
254
Direction 
Forward
Predicted Peptide Sequence 
MLNSTVEIFEQRFMTGAGKNLPEHAMICMINREESVMSELCLDAPAVDDPDKLFANTLFEVVFNESRNLPFILFVKDADKVMAGNAELYS
TFKTRLEKLLNNVIIIGSQWLEKLPDNVISIGSXIAEKLSDNVIIIGFNWLEKLPDNVITIGSQSAEKLPDNVITIVHSRLEKLPDNVIS
IGSQSA
Predicted Coding Sequence 
ATGCTGAATTCAACAGTGGAGATTTTTGAGCAACGTTTTATGACTGGTGCGGGCAAAAACCTTCCTGAACATGCAATGATTTGCATGATA
AATCGTGAAGAGTCAGTCATGAGCGAGCTGTGCTTAGACGCCCCTGCCGTGGATGATCCGGACAAGTTATTCGCTAATACATTGTTTGAG
GTTGTATTCAATGAGAGCCGGAATTTGCCATTCATTTTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGAAACGCAGAATTATATTCA
ACATTTAAAACTCGGCTTGAGAAACTTCTTAATAATGTAATTATTATTGGTTCACAGTGGCTTGAGAAGCTTCCTGATAATGTAATTAGT
ATTGGTTCAXCAATAGCTGAGAAGCTTTCTGATAATGTAATTATTATTGGTTTCAATTGGCTTGAGAAGCTTCCTGATAATGTAATTACT
ATTGGTTCACAGTCTGCTGAGAAGCTTCCTGATAATGTAATTACTATTGTTCACAGTCGGCTTGAGAAGCTTCCTGATAATGTAATTTCT
ATTGGTTCACAGTCGGCTTGA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
ATTTGGAACAAAGAGTTTATTTGGTTTTTTTTAACAAGAAACAAGTGCAACAAACATTGTATTTAAATCAATAATACTATACAATATAAT
ACAATACAACACAACACACAAGACAATACAATACAATACTCTTTATTTGGAACAAAGAGTTTATTTGGTTGGGAATAACAAGTAACACAA
GCACAACAAACTGATTGAATAATAAGTTCTATATAGACACACTGTTGGGAATGAAACAATTCCGTCCACTGCA
(5')ATGCTGAATTCAA
CAGTGGAGATTTTTGAGCAACGTTTTATGACTGGTGCGGGCAAAAACCTTCCTGAACATGCAATGATTTGCATGATAAATCGTGAAGAGT
CAGTCATGAGCGAGCTGTGCTTAGACGCCCCTGCCGTGGATGATCCGGACAAGTTATTCGCTAATACATTGTTTGAGGTTGTATTCAATG
AGAGCCGGAATTTGCCATTCATTTTGTTCGTGAAAGATGCTGACAAAGTAATGGCAGGAAACGCAGAATTATATTCAACATTTAAAACTC
GGCTTGAGAAACTTCTTAATAATGTAATTATTATTGGTTCACAGTcGGCTTGAGAAGCTTCCTGATAATGTAATTAGTATTGGTTCAXCA
ATAGCtTGAGAAGCTTTCTGATAATGTAATTATTATTGGTTTaCAATTGGCTTGAGAAGCTTCCTGATAATGTAATTACTATTGGTTCAC
AGTCTGCtTGAGAAGCTTCCTGATAATGTAATTACTATaTGTTCACAGTCGGCTTGAGAAGCTTCCTGATAATGTAATTTCTATTGGTTC
ACAGTCGGCTTGA(3')AAGCTTCCCGATATGTAATTACTAATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan