ESTScan Details for Unigene SGN-U314631

Score 
152
Direction 
Reverse
Predicted Peptide Sequence 
MELESKECCTTVKQTTIDPAKCEQAKELQNHAIGITSPHEMQPTXLLDLLLWPQLIAVTAFLLPAVHSTWVQTGIALAANHLLLVVFPGQ
GHKRRFNDPTPEPQDKMQSRFFLNIIIRQCTAHLQAVYQQRSVAAGPVEYLPCPESSFDIVDRIAGFNLKGYGFPVRVFTKICILSL
Predicted Coding Sequence 
ATGGAACTGGAGTCTAAAGAATGTTGTACCACAGTTAAACAGACAACAATAGATCCAGCAAAATGTGAGCAAGCAAAAGAACTACAAAAT
CATGCAATAGGCATAACATCTCCACATGAAATGCAACCGACTGXTCTACTTGATCTTCTTCTTTGGCCTCAACTGATTGCTGTGACCGCA
TTTCTTCTTCCTGCAGTTCACAGCACGTGGGTGCAAACGGGCATAGCACTTGCGGCAAATCATCTTCTCTTGGTTGTATTTCCTGGCCAA
GGCCATAAGAGACGGTTCAATGATCCCACCCCGGAGCCTCAGGACAAGATGCAGAGTCGATTCTTTTTGAATATTATAATCCGCCAGTGT
ACXGCCCATCTTCAAGCTGTTTACCAGCAAAGATCAGTCGCTGCTGGTCCGGTGGAATACCTTCCTTGTCCTGAATCTTCCTTTGACATT
GTCGATCGTATCGCTGGATTCAACCTCAAGGGTTATGGTTTCCCTGTTAGGGTTTTCACGAAGATCTGCATCTTATCTCTX
Edits in Original Sequence 
GGGGAAATGGGTCCCGGCCCCCCCCCCCAAAANTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTNTAAAGAAACAAAAAC
AGCCCATAATTATAACAAACTCGAAAGAGCAATAAATTCTTTTTGTAA
(5')ATGGAACTGGAGTCTAAAcGAATGTTGTACCACAGTTA
AACAGACAACAATAGATCCAGCAAAATGTGAGCtAAGCAAAAGAACTACAAAATCATGCAATAGGCATAACATCTCCACATGAAATGCAA
CCGACTGXTCTACTTGATCTTCTTCTTTGGCCTCAACTGATTGCTGTGACCGCATTTCTTCTTCCTGCAGTTCACAGCACGTGGGTGCAA
ACGGGCATAGCACTTGCGGCAAATCATCTTCTCTTGGTTGTATTTCCTGGCCAAGGCCATAAGAGACGGTTCAATGATCCCACCCCGGAG
CCTCAGGACAAGATGCAGAGTCGATTCTTTTTGAATATTATAATCCGCCAGTGTACXGCCCATCTTCAAGCTGTTTACCAGCAAAGATCA
GTCGCTGCTGGTCCGGTGGAATACCTTCCTTGTCCTGAATCTTCgCTTTGACATTGTCGATCGTATCGCTGGATTCAACCTCAAGGGTTA
TGGTcTTCCCTGTTAGGGTTTTCACGAAGATCTGCATCTTATCTCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan