ESTScan Details for Unigene SGN-U314656

Score 
772
Direction 
Forward
Predicted Peptide Sequence 
MGXYDGRDAVEAMAKEAKRNDLILRSSGTVNVDGSKNFASLFSRRGEKGVNQDCFIVWEEFGCQEDMTFCGIFDGHGPWGHFVSKKVRES
IVSSLLCIWQESLAEASADPDLDKKAQRFNIWKESFLKACATVDQELEHHPKIDTFYSGTTALTIVRQGEVLFIANVGDSRAVLATTCDD
GNLVPVQLTVDFKPNLPQETERILQCNGRVFCLDDESGVHRLWLPDESSPGLAMSRAFGDYCVKDFGLISVPDVTQRHITSKDQFVVLAT
DGVWDVISNEEAVEIVSETPDRAKAAKHLVQCAVRAW
Predicted Coding Sequence 
ATGGGAAXATATGATGGTAGAGATGCTGTTGAAGCTATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTGTA
AATGTTGATGGTTCTAAGAATTTCGCTTCATTATTCTCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGGAA
TTTGGATGCCAAGAAGACATGACATTCTGTGGTATATTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCAAAGAAGGTTCGAGAATCG
ATAGTATCATCGTTGCTTTGCATTTGGCAGGAGAGTTTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGCTCAAAGGTTTAAC
ATATGGAAGGAGTCCTTCTTAAAGGCATGTGCAACTGTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAACC
ACTGCTTTGACAATAGTCAGACAGGGTGAGGTTTTATTTATAGCAAATGTTGGTGACTCACGTGCAGTATTAGCTACCACGTGCGATGAT
GGCAACTTGGTACCAGTTCAGCTCACTGTTGATTTCAAACCTAATCTACCTCAGGAAACTGAGAGAATACTGCAGTGTAATGGTAGAGTA
TTTTGCTTAGATGATGAATCTGGGGTGCACCGATTATGGCTGCCCGACGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGGAC
TATTGCGTGAAAGATTTTGGTCTAATTTCAGTGCCTGACGTGACACAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAACA
GATGGGGTATGGGATGTTATATCGAATGAAGAGGCTGTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTGTT
CAATGTGCTGTTCGTGCTTGG
Edits in Original Sequence 
GTATGTTAGTAATGTCACTGTACAAAAATAAAACCAAACTCTGTTTGTCTCCTTTTCTCTTTCCCTTTAAAGGATCATAAACCAACGTAA
TCTTTTTAATGGATTCTCTTCTTTTCTCTCGATTTCTCAGCTCACCCCCTTCGAGTTTCCTCATTTGCCGGCAATCTTTTTCTGATTTTC
CGACCTGTTAATAACTCTCCGGCCATTTTCTCCGACCATATTCCACCGTAAAGTTAAACCAAAGGAGGGTATTTGGGTAGTTTAAATTAA
AGAAAGTTTGAAATGGGGCATTTTTCTTCAATGTTTAATGGATTAGCAAGGTCTTTTTCTTTGAAGAAAAGAAAGAATAGTTCTGGAA
(5')
ATGGGAAXATATGATGGTAGAGATGCTGTTGAAGCTATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTG
TAAATGTTGATGGTTCTAAGAATTTCGCTTCATTATTCTCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGG
AATTTGGATGCCAAGAAGACATGACATTCTGTGGTATATTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCAAAGAAGGTTCGAGAAT
CGATAGTATCATCGTTGCTTTGCATTTGGCAGGAGAGTTTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGCTCAAAGGTTTA
ACATATGGAAGGAGTCCTTCTTAAAGGCATGTGCAACTGTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAA
CCACTGCTTTGACAATAGTCAGACAGGGTGAGGTTTTATTTATAGCAAATGTTGGTGACTCACGTGCAGTATTAGCTACCACGTGCGATG
ATGGCAACTTGGTACCAGTTCAGCTCACTGTTGATTTCAAACCTAATCTACCTCAGGAAACTGAGAGAATACTGCAGTGTAATGGTAGAG
TATTTTGCTTAGATGATGAATCTGGGGTGCACCGATTATGGCTGCCCGACGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGG
ACTATTGCGTGAAAGATTTTGGTCTAATTTCAGTGCCTGACGTGACACAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAA
CAGATGGGGTATGGGATGTTATATCGAATGAAGAGGCTGTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTG
TTCAATGTGCTGTTCGTGCTTGG(3')AAACGTAAGAGGAGAGGGATAGCTGTAGATGATATTTCAGCCATTGTACTCTTCTTTCATTCT
AAGCATTTCTGTCAGCATATTTACCCTGTAACTACTCCAAAATAAGAAAACGCAAGTTTCTGTCACATGTTCTCCATCTTACCTGATTTT
AGTTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan