ESTScan Details for Unigene SGN-U314689

Score 
956
Direction 
Forward
Predicted Peptide Sequence 
MTGTGDENQPKFKKSESQIPSVSSSSSDPQAPEMDPQKWGTHIMGPPAVPTCHPDNQKAASWRAEDQREEFQPQPYVVYSPIDKPSNNPL
DSVVNVFNSWSNRAENIARNIWYNLKAGPSVTEAAWGKLNLTAKALTEGGFEPLYKQIFGADPNEQLKKTFACYLSTATGPVAGTLYLST
TKVAFCSDRPLSYKAPSGQEAWSYYKVAVPLGNIGTINPIVMKESPPERYIQIVTIDGHDFWFMGFVNFDKAKHHLLETLSIFRAQPPHL
NLQQPAATXLEALPVLCFSVFFFLFVPALDMYLYFFYCNILVCLYIFGSDYVRFDVNKSSLRFNLFXLVLIDIEDFXDLKVKKKFGCTDA
TQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY
Predicted Coding Sequence 
ATGACAGGCACAGGAGACGAAAATCAACCCAAATTTAAAAAATCAGAGTCTCAAATACCTTCTGTTTCTTCATCATCTTCAGATCCACAA
GCACCAGAAATGGATCCCCAAAAATGGGGTACCCATATTATGGGTCCGCCTGCAGTTCCAACTTGTCATCCAGACAATCAGAAAGCTGCT
TCATGGAGAGCTGAGGATCAAAGAGAAGAGTTTCAGCCACAGCCTTATGTTGTTTATTCCCCAATTGATAAGCCTAGCAATAACCCACTT
GATTCCGTTGTTAATGTGTTCAATTCATGGAGTAACAGAGCTGAGAACATAGCTCGCAACATTTGGTATAATCTGAAAGCTGGACCGTCA
GTTACAGAAGCGGCATGGGGAAAACTTAATTTGACAGCTAAGGCGTTGACAGAGGGTGGATTTGAGCCTCTTTACAAGCAGATTTTTGGA
GCAGATCCTAATGAACAGCTGAAAAAGACGTTTGCTTGTTATCTTTCTACTGCGACTGGGCCTGTTGCTGGTACACTCTATCTGTCAACT
ACTAAAGTTGCTTTTTGCAGCGATCGGCCATTATCATACAAAGCTCCATCTGGTCAGGAGGCCTGGAGCTACTACAAGGTAGCAGTACCG
TTGGGAAATATTGGGACTATAAACCCAATAGTGATGAAAGAGTCTCCACCAGAGAGGTACATTCAGATTGTTACCATCGATGGTCATGAT
TTCTGGTTCATGGGGTTTGTGAATTTTGATAAAGCAAAACATCATCTACTTGAAACTTTGTCAATTTTTAGAGCACAACCCCCTCATCTC
AATCTGCAACAACCAGCAGCTACTXTACTAGAAGCATTGCCTGTACTCTGTTTTAGTGTGTTTTTTTTCCTGTTTGTTCCTGCATTAGAT
ATGTATTTGTATTTCTTTTATTGTAACATTCTTGTATGTTTATACATATTCGGGAGTGACTATGTTCGTTTTGATGTAAATAAAAGTTCT
TTGCGTTTTAATTTATTTGXTCTTGTTTTGATTGATATAGAAGATTTTGAXGATTTGAAGGTAAAAAAAAAGTTTGGGTGCACTGATGCA
ACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTG
CAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
TGGCGGCCAAATCGGCCGAATTGGTATAATCTTATTACCGAAGCAAAAGAAAATGAAAACGCGTACACGTTCTACATAATCATCATCTAT
AAATTATTATAATTCCAATAACTGTGTATCTCTTAAGACAAAATTCACTCAAAATTCAACTACTCAAAGCAATTTACAATCAATTTCTCG
AATC
(5')ATGACAGGCACAGGAGACGAAAATCAACCCAAATTTAAAAAATCAGAGTCTCAAATACCTTCTGTTTCTTCATCATCTTCAG
ATCCACAAGCACCAGAAATGGATCCCCAAAAATGGGGTACCCATATTATGGGTCCGCCTGCAGTTCCAACTTGTCATCCAGACAATCAGA
AAGCTGCTTCATGGAGAGCTGAGGATCAAAGAGAAGAGTTTCAGCCACAGCCTTATGTTGTTTATTCCCCAATTGATAAGCCTAGCAATA
ACCCACTTGATTCCGTTGTTAATGTGTTCAATTCATGGAGTAACAGAGCTGAGAACATAGCTCGCAACATTTGGTATAATCTGAAAGCTG
GACCGTCAGTTACAGAAGCGGCATGGGGAAAACTTAATTTGACAGCTAAGGCGTTGACAGAGGGTGGATTTGAGCCTCTTTACAAGCAGA
TTTTTGGAGCAGATCCTAATGAACAGCTGAAAAAGACGTTTGCTTGTTATCTTTCTACTGCGACTGGGCCTGTTGCTGGTACACTCTATC
TGTCAACTACTAAAGTTGCTTTTTGCAGCGATCGGCCATTATCATACAAAGCTCCATCTGGTCAGGAGGCCTGGAGCTACTACAAGGTAG
CAGTACCGTTGGGAAATATTGGGACTATAAACCCAATAGTGATGAAAGAGTCTCCACCAGAGAGGTACATTCAGATTGTTACCATCGATG
GTCATGATTTCTGGTTCATGGGGTTTGTGAATTTTGATAAAGCAAAACATCATCTACTTGAAACTTTGTCAATTTTTAGAGCACAACCCC
CTCATCTCAATCTGCAACAACCAGCAGCTACTXTACTAGAAGCATTGCCTGTACTCTGTTTTAGTGTGTTTTTTTTCCTGTTTGTTCCTG
CATTAGATATGTATTTGTATTTCTTTTATTGTAACATTaCTTGTATGTTTATACATATTCGGGAGTGACTATGTTCGTTTTGATGTAAAT
AAAAGTTCTTTGCGTTTTAATTTATTTGXTCTTGTTTTGAcTTGATATAGAAGATTTTGAXGATTTGAAGGTAAAAAAAAAGTTTGGGTG
CACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGT
TCGTCAAGTGCAGTGCATCAGTTTCATCGCTTACAAGCCCGAAGGATACTAA(3')AATGCCAATTTTTAATTATGTAATGTATAACTGA
CCCTATGTATTTAGGGGAAGCTTGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACTTTGTTGTGTTCCCTTC
ATCTTTTGAATTAATGGCATTTGTTTTAATACTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan