ESTScan Details for Unigene SGN-U314690

Score 
251
Direction 
Forward
Predicted Peptide Sequence 
SSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRXQLHAGLCVYIYICTTKFIDYNAILDXANLTIYNCIGVPPIN
MKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEVNPVFKIYILASVLICCVNSVVGYHVQHGFVYRENHKSPGYYDGRYWTMWK
LPMFGCTDATQVLAEVQEAKKAYPQAWVRX
Predicted Coding Sequence 
XTTTCTTCAGCTGCTGTTGCCACCCGCGGCAATGGTGCACAAGCTAGCATGGTTGCACCCTTCACTGGACTCAAGTCCACTGCTTCTTTC
CCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGXTCAGTTGCATGCAGGTTTGTGTGTGTATATA
TATATATGTACAACAAAATTCATTGACTATAATGCTATACTCGATXTAGCTAATTTAACTATTTATAATTGTATAGGTGTGCCACCAATT
AACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGA
TGGGTTCCTTGCTTGGAATTCGAGACTGAGGTTAACCCTGTTTTTAAAATTTATATATTAGCTAGTGTGTTGATATGTTGTGTTAATAGT
GTTGTGGGATATCATGTGCAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGG
AAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAAGCTTACCCTCAAGCATGGGTCCGT
AXX
Edits in Original Sequence 
(5')XTTTCTTCAGCTGCTGTTGCCACCCGCGGCAATGGTGCACAAGCTAGCATGGTTGCACCCTTCACTGGACTCAAGTCCACTGCTTC
TTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGAAGAGXTCAGTTGCATGCAGGTTTGTGTGTGTA
TATATATATATGTACAACAAAATTCATTGACTATAATGCTATACTCGATXTAGCTAATTTAACTATTTATAATTGTATAGGTGTgGCCAC
CAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAA
ATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGGTTAACCtCTGTTTTTAAAATTTATATATTAGCTAGTGTGTTGATATGTTGTGTT
AATAGTGTTGTGGGATATCATGTGCAGCACGGATTTGTGTACCGTGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACC
ATGTGGAAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAGGTGCAGGAGGCAAAGAAAGCTTACCCTCAAGCATGG
GTCCGTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan