ESTScan Details for Unigene SGN-U314694

Score 
482
Direction 
Forward
Predicted Peptide Sequence 
EMLLLAIKHANSDEILLLKNVPTLECAEQSTFDLKSDGMVKNICKPSETNDFQDLLGKINRYRKYYGIDVPNVEYEITVGFKLKFFFVHQ
GRFSILVIWSCQCSAAVATRGNGAQASMVAPFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLL
SEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIA
YKPEGY
Predicted Coding Sequence 
XCTGAAATGTTGTTGCTTGCCATTAAACATGCCAATTCAGATGAGATTTTGCTTCTAAAGAATGTGCCGACTTTAGAATGTGCCGAGCAG
TCTACATTTGATCTGAAATCTGATGGTATGGTGAAGAATATATGTAAGCCATCTGAGACGAATGATTTTCAAGATTTGCTGGGTAAAATA
AATAGATATCGTAAGTACTATGGAATTGATGTTCCTAATGTTGAATATGAGATAACTGTAGGTTTTAAACTGAAATTCTTCTTTGTTCAT
CAAGGAAGGTTTAGTATTTTGGTTATATGGAGCTGCCAGTGTTCAGCTGCTGTTGCCACCCGCGGCAATGGTGCACAAGCTAGCATGGTT
GCACCCTTCACTGGACTCAAGTCCACTGCTTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAGCAACGGTGGA
AGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGACGAGCAATTG
CTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCGTGAGAACCAT
AAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGTCTTGGCTGAG
GTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCATCAGTTTCATC
GCTTACAAGCCCGAAGGATACTAA
Edits in Original Sequence 
(5')XCTGAAATGTTGTTGCTTGCCATTAAACATGCCAATTCAGATGAGATTTTGcCTTCTAAAGAATGTGCCGACTTTAGAATGTGCCG
AGCAGTCTACATTTGATCTGAAtATCTGATGGTATGGTGAAcGAATATATGTAAGCCATCTGAGACGAATGATTTTCAAGATTTGCTGGG
TAtAAATAAATAGATATCGTAAGTACTATGtGAATTGATGTTCCTAATGTTGAATATGAGATAACTGTAGGTTTTAAACTGAAATTaCTT
CTTTGTTCATCAAGGAAGGTTTAGTATTTTGGTTATATGGAGCTGCCAGTGTTCAGCTGCTGTTGCCACCCGCGGCAATGGTGCACAAGC
TAGCATGGTTGCACCCTTCACTGGACTCAAGTCCACTGCTTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCTCCATTGCTAG
CAACGGTGGAAGAGTCAGTTGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTGTCGTACCTTCCTGATTTGTCCGA
CGAGCAATTGCTCAGCGAAATTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGCACGGATTTGTGTACCG
TGAGAACCATAAGTCACCAGGATACTACGATGGCAGATACTGGACCATGTGGAAGTTGCCCATGTTTGGGTGCACTGATGCAACCCAGGT
CTTGGCTGAGGTGCAGGAGGCAAAGAAGGCTTACCCTCAGGCATGGGTCCGTATCATCGGATTCGACAATGTTCGTCAAGTGCAGTGCAT
CAGTTTCATCGCTTACAAGCCCGAAGGATACTAA(3')AATGCCAATTTTTAATTATGTAATGTATAACTGACCCTATGTATTTAGGGGA
AGCTTGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACTTTGTTGTGTTCCCTTCAAAAAAAAAAAAAAAAAA
CTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan