ESTScan Details for Unigene SGN-U314715

Score 
406
Direction 
Reverse
Predicted Peptide Sequence 
MKDVVQQKFPNSATVRSLALPADKVELTHDVKDRNKGYEANTHHKHNIGGYLESGGIISVELKHGTTAPPAAPPAPPVFLRRRLAAAAAA
VPLCGPPPPNAISSHLRMLRIRENGFSDXGRKMDEKYFDAFX
Predicted Coding Sequence 
ATGAAAGATGTTGTCCAACAAAAATTTCCCAACTCAGCAACGGTTCGGTCACTAGCCCTCCCTGCGGACAAAGTAGAGCTTACCCATGAC
GTGAAGGATCGCAACAAAGGCTATGAAGCCAATACTCATCACAAGCACAACATTGGGGGATATCTTGAGTCCGGGGGAATCATCAGTGTA
GAATTGAAGCATGGTACCACCGCTCCTCCTGCAGCTCCACCTGCTCCTCCTGTCTTCCTTCGACGTAGGTTAGCAGCTGCTGCTGCTGCA
GTCCCTCTTTGTGGTCCACCTCCACCCAATGCCATTTCTAGTCACTTAAGAATGCTGAGAATTAGGGAAAATGGATTCTCCGATXCTGGA
AGGAAAATGGATGAGAAGTATTTTGACGCGTTTCXX
Edits in Original Sequence 
CCGGGAAAAATTTTTTCCCCGTTTTTCCCCCCCCTTTTTGGGGGCCCCAAAAAAATTTCCAGGGGGCCCCTTTGGGGGGGNNTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGACTCATAACTAGAAAACTTTTCTATAGACTCCAT
AGCATTAGACAAACAAACAAGAAAATAAAGCTACAATGTCAGTTTTTCCTTAAACG
(5')ATGAAAGATGTTGTCCAACAAAAATTTCCC
AACTCAGCAACGGTTCGGTCACTAGCCCTCCCTGCGGACAAAGTAGAGCTTACCCATGACGTGAAGGATCGCAACAAAGGCTATGAAGCC
AATACTCATCACAAGCACAACATTGGGGGATATCTTGAGTCCGGGGGAATCATCAGTGTAGAATTGAAGCATGGTACCACCtGCTCCTCC
TGCAGCTCCACCTGCTCCTCCTGTCTTCCTTCGACGTAGGTTAGCAGCTGCTGCTGCTGCAGTCCCTCTTTGTGGTCCACCTCCACCCAA
TGCCATTTCTAGTCACTTAAGAATGCTGAGAATTAGGGAAAATGGATTCTCCGATXCTGGAAGGAAAATGGATGAGAAGTATTTTGACGC
GTTTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan