Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U314779

Score 
724
Direction 
Forward
Predicted Peptide Sequence 
MCVVSLVVLLSIITISPLAQAQGLGLIVRPILGQPAPPIVPPVGQVPPIGLGQLPIVGSFLGPILSPILGQPIVPPIGQVPPVGLGQLSI
LGPILGPILGPILGPILGQPIVPPINTPPILPPINTPPIVPPVGQVPPIVPPIVPPVGQVPPIVPPVGQVPPIVPPIVPPVINLTILGSL
SCSVPGSNAPGLGVSGANVTIICGNTTIAQVSTNSQGIINAAVSTNTSLLSGTCIARIPLPIANCTLTPTTGALVAPRYPYWKLSSECGG
SNFDSNFGDTYISSNRHYYLGLPPSSLTPK
Predicted Coding Sequence 
ATGTGTGTTGTTTCTCTTGTTGTTCTACTTTCCATCATCACCATCAGTCCTCTAGCCCAAGCTCAAGGTTTGGGTCTCATTGTTCGTCCC
ATTTTGGGGCAACCTGCACCACCTATTGTACCACCCGTTGGTCAAGTACCACCTATTGGTCTTGGCCAATTACCGATTGTTGGTTCTTTT
CTTGGTCCCATTCTTAGTCCTATTCTTGGCCAACCCATTGTACCACCCATTGGTCAAGTACCACCTGTTGGTCTTGGCCAATTATCGATT
CTTGGTCCTATTCTTGGTCCAATTCTCGGTCCCATTCTTGGTCCTATTCTTGGCCAACCCATTGTACCACCCATTAATACACCACCGATT
TTACCACCCATTAATACACCACCGATTGTACCACCTGTTGGTCAAGTACCACCGATTGTACCACCGATTGTACCACCTGTTGGTCAAGTA
CCACCGATTGTACCACCTGTTGGTCAAGTACCACCGATTGTACCACCGATTGTACCACCGGTTATTAATTTAACTATATTAGGGAGTTTG
TCTTGCTCCGTACCGGGAAGTAATGCCCCAGGCCTCGGAGTGAGTGGAGCAAATGTAACGATTATTTGTGGCAACACAACGATTGCTCAA
GTGTCCACAAATAGTCAAGGCATTATTAATGCTGCAGTGTCCACCAATACAAGTCTTTTGTCAGGAACATGTATTGCAAGGATTCCTCTC
CCAATTGCTAATTGCACTTTGACTCCAACCACAGGAGCCCTTGTAGCTCCXCGTTATCCTTATTGGAAACTTAGTTCAGAATGTGGTGGA
TCAAACTTTGACAGCAATTTTGGGGATACTTACATCTCTAGCAACCGTCACTATTACCTAGGACTACCTCCATCATCACTCACACCTAAA
TAA
Edits in Original Sequence 
AA(5')ATGTGTGTTGTTTCTCTTGTTGTTCTACTTTCCATCATCACCATCAGTCCTCTAGCCCAAGCTCAAGGTTTGGGTCTCATTGTT
CGTCCCATTTTGGGGCAACCTGCACCACCTATTGTACCACCCGTTGGTCAAGTACCACCTATTGGTCTTGGCCAATTACCGATTGTTGGT
TCTTTTCTTGGTCCCATTCTTAGTCCTATTCTTGGCCAACCCATTGTACCACCCATTGGTCAAGTACCACCTGTTGGTCTTGGCCAATTA
TCGATTCTTGGTCCTATTCTTGGTCCAATTCTCGGTCCCATTCTTGGTCCTATTCTTGGCCAACCCATTGTACCACCCATTAATACACCA
CCGATTTTACCACCCATTAATACACCACCGATTGTACCACCTGTTGGTCAAGTACCACCGATTGTACCACCGATTGTACCACCTGTTGGT
CAAGTACCACCGATTGTACCACCTGTTGGTCAAGTACCACCGATTGTACCACCGATTGTACCACCGGTTATTAATTTAACTATATTAGGG
AGTTTGTCTTGCTCCGTACCGGGAAGTAATGCCCCAGGCCTCGGAGTGAGTGGAGCAAATGTAACGATTATTTGTGGCAACACAACGATT
GCTCAAGTGTCCACAAATAGTCAAGGCATTATTAATGCTGCAGTGTCCACCAATACAAGTCTTTTGTCAGGAACATGTATTGCAAGGATT
CCTCTCCCAATTGCTAATTGCACTTTGACTCCAACCACAGGAGCCCTTGTAGCTCCXCGTTATCCTTATTGGAAACTTAGTTCAGAATGT
GGTGGATCAAACTTTGACAGCAATTTTGGGGATACTTACATCTCTAGCAACCGTCACTATTACCTAGGACTACCTCCATCATCACTCACA
CCTAAATAA(3')ATGAAGTGCCCTCATCCATCTTTTAATTATCATGTAATATTATATTATATTATATTATATTAAATGGTGAGATTGGA
TAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAATGCATATATGCATCAAGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan