ESTScan Details for Unigene SGN-U314785

Score 
544
Direction 
Forward
Predicted Peptide Sequence 
MLMRFTPPIQIKDPSYHRVCXPGFAVQQLTQTRVSFVDSGGQXHVGNFRITLLSTNLGFITLSFTHKLVVFTVIVATLVSRATWVHPVGL
IIVGPSEGDILNKQFYDHIPWDNVRLAFLGQIVLPNESSISVVIFATFVAAQHVVHMGVLGLPSERGHIXIAKITTFYGTRPGIYDITDL
DLSPRLHGETLTKNKQVSKESNIFGTAINYYLLCFLLVPNSARGSTTPKIQWGYSKTHCFSFXFMILAIFHSCDAQNSPQDYLVVHNNAR
GQVGVGPMSWDNALATKAQRYADSRRGDCNLIHSGPGENLAKGSGDFTGRRASELWVAEKPNYNYGTXPMCXWESGGHYTQVVWRNSVRL
GCGRARCNNGWWFICCNYDPVGNWVGQVLTKRMFTYDMLLVLNKIPDETSEKLNFKFDIWIKSISYQNIKGLNIEIYNYYYFPFDVANMN
XFHIPKKKKKIKLINCIFADKTLIYLKRKKTLLIRSMATQKPTPSTTKTVTSKKTTTVFPVGEKPRPGNSSSTPPVKXIDKSGAIATLTK
AEKAGLLSAAEKSGLSLSTIERLGLLSKAEELGILSAATDPSTPSALFSLSLGLLAVGPVCVYLVPEDYPWQIGLQVVVALLSVVGGSAA
FGASNLVSTLQKVN
Predicted Coding Sequence 
ATGTTAATGAGGTTTACACCTCCGATACAAATTAAAGATCCATCTTACCATAGAGTTTGCAXCCCTGGTTTTGCAGTACAACAATTGACA
CAAACTCGAGTAAGTTTTGTCGATTCAGGTGGACAAGXTCATGTAGGCAACTTTAGGATCACATTGTTGAGTACAAACCTTGGGTTCATT
ACTCTGTCCTTCACACACAAACTTGTTGTCTTTACCGTAATAGTAGCAACCCTTGTATCCCGTGCAACATGGGTGCATCCAGTGGGTTTA
ATTATAGTTGGTCCTTCTGAAGGGGACATTTTGAATAAGCAATTTTACGATCACATTCCTTGGGACAACGTTCGTTTGGCTTTCTTGGGT
CAGATTGTCCTTCCAAATGAAAGTTCCATTAGCGTTGTAATATTTGCAACCTTTGTAGCTGCACAACATGTGGTACATATGGGGGTTCTT
GGACTTCCTTCTGAACGTGGACATATCGXCATAGCTAAAATTACCACATTCTATGGTACAAGGCCTGGGATTTATGATATCACXGATCTT
GATCTATCTCCGCGCTTACATGGAGAAACATTAACCAAGAACAAGCAAGTAAGCAAGGAAAGTAATATCTTTGGAACAGCCATTAATTAC
TACTTACTTTGTTTTCTCCTCGTGCCGAATTCGGCACGAGGCTCAACTACACCTAAAATTCAATGGGGTTATTCAAAAACACATTGTTTC
TCTTTTGXTTTCATGATATTAGCCATATTTCACTCTTGTGACGCTCAAAATTCACCACAAGACTATCTTGTGGTTCACAACAATGCTCGT
GGTCAAGTCGGGGTTGGGCCTATGTCTTGGGATAACGCCTTGGCAACCAAAGCACAAAGGTATGCTGACTCAAGAAGAGGTGATTGCAAC
TTGATTCATTCTGGTCCAGGAGAGAATCTTGCCAAGGGTAGTGGAGACTTCACGGGGAGGCGTGCCTCTGAATTGTGGGTGGCGGAGAAG
CCAAACTACAACTATGGTACCAAXCCAATGTGCTAGTGGGAAAGTGGCGGACACTATACTCAAGTAGTTTGGCGTAATTCTGTCAGGCTT
GGTTGTGGTCGGGCTCGTTGCAACAACGGATGGTGGTTCATTTGTTGCAACTATGATCCTGTAGGCAATTGGGTCGGACAAGTCCTTACT
AAAAGGATGTTTACTTATGACATGTTGCTAGTATTAAATAAAATTCCAGATGAGACGTCXGAGAAGTTAAACTTTAAGTTTGACATATGG
ATCAAGTCAATCTCCTATCAAAATATTAAGGGATTAAATATTGAAATCTATAATTATTATTATTTCCCTTTTGATGTTGCTAATATGAAT
AAXTTCCACATACCAAAAAAAAAAAAAAAGATTAAGTTGATTAACTGCATCTTTGCXGATAAAACATTAATATACTTAAAACGCAAAAAA
ACACTTCTCATCCGATCCATGGCGACGCAAAAACCAACTCCATCCACTACCAAAACCGTTACTTCTAAAAAGACAACAACTGTATTTCCA
GTAGGGGAGAAACCTAGGCCGGGCAATTCTTCGTCTACACCACCAGTGAAGXTTATTGACAAGAGTGGAGCAATTGCGACGTTAACTAAA
GCAGAGAAAGCTGGTTTACTATCAGCTGCTGAGAAATCTGGACTCTCTTTGTCGACAATTGAAAGACTTGGTCTTCTTTCAAAAGCTGAA
GAATTGGGGATTCTTTCAGCAGCTACTGACCCTTCAACTCCATCAGCACTCTTCAGTTTGAGTTTGGGATTGTTGGCCGTGGGTCCTGTT
TGTGTGTATCTGGTGCCTGAAGATTACCCTTGGCAAATTGGTTTGCAGGTTGTGGTTGCTCTTCTTTCTGTTGTTGGTGGCTCTGCAGCT
TTTGGAGCCTCAAATCTTGTTTCCACTTTGCAGAAAGTAAATTGA
Edits in Original Sequence 
AGCAAAAAAACATCAAGGTAAAAAAACTCAGAGCTCCAGGTCTCCTGACATTACATAAAAGGACCAAATTGTACTACATTCATTATTCAT
GAAGTGAAAACACTGAAAAACATCTTATTTTGATGCGGACAACTCGACCAGGAGAATGCCATGAAATGTATTTAGCAACAGAAAAGTCAG
TCTGCTGTCCAGCTTTGCTCAAGTATTTCACGCACCTTCCTGTTGTAGTCGCGCTTGTTCTCACTAAATAGACGTGCAGCTTCTGAATTA
GCTGGCGAATTGGGGTTTTTTTTTTTTTTTTTTTTTTTTTTTCGAAGTAAAATATTTTATTAATTTATTGCGCAAGCGGTGGAAAAAGCT
CCAATGCCCACATTACATAGATTAGCATGACAATAATATTTGTATCGTCATACTTTTATTTCGTAA
(5')ATGTTAATGAGGTTTaACAC
CTCCGATACAAATTAAAGATCCATCgTTACCATAGAGTTTGCAXCCCTGGTTTTGCAGTACAACAATTGACACAAACTCGAGTAAGTTTT
GTCGATTCAGGTGGACAAGXTCATGTAGGCAACTTTAGGATCACATTGTTGAGTACAAACCTTGGGTTCATTACTCTGTCCTTCACACAC
AAACTTGTTGTCTTTACCGTAATAGTAGCAACCCTTGTATCCCGTGCAACATGtGGTGCATCCAGTGGGTTTAATTATAGTTGGTCCTTC
TGAAcGGGGACATTTTGAATAAGCAATTTTACGATCACATTCCTTGGGACAACGTTCGTTTGGCTTTCTTGGGTCAGATTGTCCTTCaCA
AATGAAAGTTCCATTAGCGTTGTAATATTTGCAACCTTTGTAGcCTGCACAACATGTGGTACATATGGGGGTTCTTGGACTTCCTTCTGA
ACGTGGACATATCGXCATAGCTAAAATTACCACATTCTATGGTACAAGGCCTGGGATTTATGATATCACXGATCTTGATCTATCTCCGCG
CTTACATGGAGAAACATTaAACCAAGAACAAGCAAGTAAGCAAGGAAAGTAATATCTTTGtGAACAGCCATTAATTACTACTTACTTTGT
TTTCTCCTCGTGCCGAATTCGGCACGAGGCTCAACTACACCTAAAATTCAATGGGGTTATTCAAAAACACATTGTTTCTCTTTTGXTTTC
ATGATATTAGCCATATTTCACTCTTGTGACGCTCAAAATTCACCACAAGACTATCTTGTGGTTCACAACAATGCTCGTGGTCAAGTCGGG
GTTGGGCCTATGTCTTGGGATAACGCCTTGGCAACCAAAGCACAAAGGTATGCTGACTCAAGAAGAGGTGATTGCAACTTGATTCATTCT
GGTCCAGGAGAGAATCTTGCCAAGGGTAGTGGAGACTTCACGGGGAGGCGTGCCTCTGAATTGTGGGTGGCGGAGAAGCCAAACTACAAC
TATGGTACCAAXCCAATGTGCTAGTGGGAAAGTGtGCGGACACTATACTCAAGTAGTTTGGCGTAATTCTGTCAGGCTTGGTTGTGGTCG
GGCTCGTTGCAACAACGGATGGTGGTTCATTTGTTGCAACTATGATCCTGTAGGCAATTGGGTCGGACAAcGTCCTTACTAAAAGGATGT
TTACTTATGACATGTTGCTAGTATTAAATAAAATTCtCAGATGAGACGTCXGAGAAGTTAAACTTTAAGTTTGACATATGGATCAAGTCA
ATCTCCTATCtAAAATATTAAGGGATTAAATATTGAAcATCTATAATTATTATTATTTCCCTTTTGATGTTGCTAATATGAATAAXTTCC
ACATACCAAAAAAAAAAAAAAAGATTAAGTTGATTAACTGCATCTTTGCXGATAAAACATTAATATACTTAAAACGCAAAAAAACACTTC
TCATCCGATCCATGGCGACGCAAAAACCAACTCCATCCACTACCAAAACCGTTACTTCTAAAAAGACAACAACTGTATTTCCAGTAGGGG
AGAAACCTAGGCCGGGCAATTCTTCGTCTACACCACCAGTGAAGXTTATTGACAAGAGTGGAGCAATTGCGACtGTTAACTAAAGCAGAG
AAAGCTGGTTTACTATCAGCTGCTGAGAAATCTGGACTCTCTTTGTCGACAATTGAAAGACTTGGTCTTCTTTCAAAAGCTGAAGAATTG
GGGATTCTTTCAGCAGCTACTGACCCTTCAACTCCATCAGCACTCTTCAGTTTGAGTTTGGGATTGTTGGCCGTGGGTCCTGTTTGTGTG
TATCTGGTGCCTGAAGATTACCCTTGGCAAATTGGTTTGCAGGTTGTGGTTGCTCTTCTTTCTGTTGTTGGTGGCTCTGCAGCTTTTGGA
GCCTCAAATCTTGTTTCCACTTTGCAGAAAGTAAATTGA(3')TATGTAAGCTGAAAAATACTTTCTCTGTTAGAAAATTTCTGTTATTT
ATAGTATAAATGTTAGTTTTGCTCAATCTTGATTATTTTTTGTTGATCCCGTGCAATCTAAGATATACACTGTCCTTCCTGGTAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan